TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01376 XX ID T01376 XX DT 18.11.1994 (created); ewi. DT 28.02.2006 (updated); mkl. CO Copyright (C), QIAGEN. XX FA E7 XX SY E7; E7 protein. XX OS HPV-16, human papilloma virus type 16 OC viridae; ds-DNA nonenveloped viruses; papovaviridae; papillomavirus XX HO 12S E1A (adenovirus). XX SZ 98 AA; 11.0 kDa (gene) (calc.). XX SQ MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCK SQ CDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP XX SC translated from EMBL#U76411 XX FT 1 95 PF00527; E7 protein, Early protein. XX FF alters interaction of cellular E2F with other cellular factors; FF similar to adenoviral 12S E1A; FF can interact with and transactivate factors of the AP1 family [2]; XX IN T00133 c-Jun; human, Homo sapiens. IN T34034 p21Cip1; human, Homo sapiens. IN T00722 pRb; human, Homo sapiens. XX DR TRANSPATH: MO000025631. DR EMBL: U76411; DR UniProtKB: P03129; XX RN [1]; RE0001169. RX PUBMED: 1834862. RA Phelps W. C., Bagchi S., Barnes J. A., Raychaudhuri P., Kraus V., Muenger K., Howley P. M., Nevins J. R. RT Analysis of trans activation by human papilloma virus type 16 E7 and adenovirus 12S E1A suggests a common mechanism RL J. Virol. 65:6922-6930 (1991). RN [2]; RE0012647. RX PUBMED: 8617242. RA Antinore M. J., Birrer M. J., Patel D., Nader L., McCance D. J. RT The human papillomavirus type 16 E7 gene product interacts with and trans-activates the AP1 family of transcription factors RL EMBO J. 15:1950-1960 (1996). XX //