TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01397 XX ID T01397 XX DT 10.12.1994 (created); ewi. DT 21.09.2011 (updated); jag. CO Copyright (C), QIAGEN. XX FA c-Ets-2 XX SY c-Ets-2; c-Ets-2 58-64; Ets-2; Ets2; p58-64c-Ets-2. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G004761 Ets2. XX CL C0016; ETS. XX SZ 468 AA; 52.8 kDa (cDNA) (calc.), 56 kDa (SDS) XX SQ MNDFGIKNMDQVAPVANSFRGTLKRQPAFDTFDGSLFAVLPSLSEDQTLQEVPTGLDSVS SQ HDSASCELPLLTPCSKAVMSQALKATFSGFQKEQRRLGIPKNPWLWSEQQVCQWLLWATN SQ EFSLVNVNLHQFGMNGQMLCNLGKERFLELAPDFVGDILWEHLEQMIKENQEKTEDQYEE SQ NSHLNAVPHWINSNTLGFSMEQAPYGMQAPNYPKDNLLDSMCPPSATPAALGSELQMLPK SQ SRLNTVNVNYCSISQDFPSSNVNLLNNNSGKPKDHDSPENGGDSFESSDSLLRSWNSQSS SQ LLDVQRVPSFESFEEDCSQSLCLSKLTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGSG SQ PIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRGL SQ RYYYDKNIIHKTSGKRYVYRFVCDLQNLLGFTPEELHAILGVQPDTED XX SC Swiss-Prot#P15037 XX FT 30 393 PF00478; IMP dehydrogenase / GMP reductase domain. FT 87 170 PF02198; Sterile alpha motif (SAM)/Pointed domain. FT 87 170 SM00251; SAM2_3. FT 102 168 POINTED domain of homology [5]. FT 361 444 PF00178; Ets-domain. FT 361 446 SM00413; etsneu2. FT 362 442 PS50061; ETS_DOMAIN_3. FT 364 432 PS50140; HSF_ETS. FT 454 468 repression of DNA-binding [1]. XX SF 16 C-terminal AA repress DNA-binding; XX EX brain,,,Theiler Stage 24; low; Northern blot; total RNA; [4]. EX brain,,,adult; detectable; Northern blot; mRNA (poly-A); [4]. EX heart,,,Theiler Stage 23; low; Northern blot; total RNA; [4]. EX heart,,,Theiler Stage 24; low; Northern blot; total RNA; [4]. EX heart,,,adult; detectable; Northern blot; mRNA (poly-A); [4]. EX intestine,,,Theiler Stage 23; low; Northern blot; total RNA; [4]. EX intestine,,,Theiler Stage 24; low; Northern blot; total RNA; [4]. EX intestine,,,adult; detectable; Northern blot; mRNA (poly-A); [4]. EX kidney (right and left),,,Theiler Stage 23; low; Northern blot; total RNA; [4]. EX kidney (right and left),,,Theiler Stage 24; low; Northern blot; total RNA; [4]. EX kidney (right and left),,,adult; detectable; Northern blot; mRNA (poly-A); [4]. EX liver,,,Theiler Stage 24; low; Northern blot; total RNA; [4]. EX liver,,,adult; detectable; Northern blot; mRNA (poly-A); [4]. EX lung,,,Theiler Stage 23; low; Northern blot; total RNA; [4]. EX lung,,,Theiler Stage 24; low; Northern blot; total RNA; [4]. EX lung,,,adult; detectable; Northern blot; mRNA (poly-A); [4]. EX spleen,,,Theiler Stage 23; low; Northern blot; total RNA; [4]. EX spleen,,,Theiler Stage 24; low; Northern blot; total RNA; [4]. EX spleen,,,adult; detectable; Northern blot; mRNA (poly-A); [4]. EX stomach,,,Theiler Stage 23; low; Northern blot; total RNA; [4]. EX stomach,,,Theiler Stage 24; low; Northern blot; total RNA; [4]. EX stomach,,,adult; detectable; Northern blot; mRNA (poly-A); [4]. EX thymus,,,Theiler Stage 23; medium; Northern blot; total RNA; [4]. EX thymus,,,Theiler Stage 24; medium; Northern blot; total RNA; [4]. EX thymus,,,adult; medium; Northern blot; mRNA (poly-A); [4]. EX yolk sac,,,Theiler Stage 12; low; Northern blot; total RNA; [4]. EX yolk sac,,,Theiler Stage 14; low; Northern blot; total RNA; [4]. EX yolk sac,,,Theiler Stage 16; low; Northern blot; total RNA; [4]. EX yolk sac,,,Theiler Stage 18; low; Northern blot; total RNA; [4]. EX yolk sac,,,Theiler Stage 20; low; Northern blot; total RNA; [4]. XX FF mitogenic and oncogenic activity [2]; FF even a slight overexpression causes skeletal abnormalities [6]; FF the full-length Ets2 does not bind in vitro to a DNA probe containing the two ets sites of the promoter TGFBR2 [7]; XX IN T01318 CBP; mouse, Mus musculus. IN T08499 CBP; mouse, Mus musculus. IN T23091 p300; Mammalia. XX MX M01989 V$CETS2_01. MX M07379 V$ETS2_Q4. MX M01207 V$ETS2_Q6. MX M08881 V$ETSLIKE_Q4. MX M00340 V$ETS_B. MX M00771 V$ETS_Q4. MX M00971 V$ETS_Q6. XX BS R26463. BS R21799. BS R12538. BS R14491. BS R73990. BS R21430. BS R30131. BS R73955. BS R16946. BS R16977. BS R16978. BS R14393. XX DR TRANSPATH: MO000025645. DR TRANSCOMPEL: C00086. DR TRANSCOMPEL: C00136. DR TRANSCOMPEL: C00185. DR TRANSCOMPEL: C00238. DR TRANSCOMPEL: C00264. DR EMBL: J04103; DR UniProtKB: P15037; XX RN [1]; RE0002584. RX PUBMED: 1409581. RA Hagman J., Grosschedl R. RT An inhibitory carboxyl-terminal domain in Ets-1 and Ets-2 mediates differential binding of Ets family factors to promoter sequences of the mb-1 gene RL Proc. Natl. Acad. Sci. USA 89:8889-8893 (1992). RN [2]; RE0002586. RX PUBMED: 2813360. RA Seth A., Watson D. K., Blair D. G., Papas T. S. RT c-ets-2 protooncogene has mitogenic and oncogenic activity RL Proc. Natl. Acad. Sci. USA 86:7833-7837 (1989). RN [3]; RE0005310. RX PUBMED: 2847145. RA Watson D. K., McWilliams-Smith M. J., Lapis P., Lautenberger J. A., Schweinfest C. W., Papas T. S. RT Mammalian ets-1 and ets-2 genes encode highly conserved proteins RL Proc. Natl. Acad. Sci. USA 85:7862-7866 (1988). RN [4]; RE0005315. RX PUBMED: 7689222. RA Kola I., Brookes S., Green A. R., Garber R., Tymms M., Papas T. S., Setz A. RT The Ets1 transcription factor is widely expressed during murine embryo development and is associated with mesodermal cells involved in morphogenetic processes such as organ formation RL Proc. Natl. Acad. Sci. USA 90:7588-7592 (1993). RN [5]; RE0005316. RX PUBMED: 8223245. RA Klaembt C. RT The Drosophila gene pointed encodes two ETS-like proteins which are involved in the development of the midline glial cells RL Development 117:163-176 (1993). RN [6]; RE0005319. RX PUBMED: 8596630. RA Sumarsono S. H., Wilson T. J., Tymms M. J., Venter D. J., Corrick C. M., Kola R., Lahoud M. L., Papas T. S., Seth A., Kola I. RT Down's syndrome-like skeletal abnormalities in Ets2 transgenic mice RL Nature 379:534-537 (1996). RN [7]; RE0034189. RX PUBMED: 14976186. RA Kopp J. L., Wilder P. J., Desler M., Kim J. H., Hou J., Nowling T., Rizzino A. RT Unique and selective effects of five Ets family members, Elf3, Ets1, Ets2, PEA3, and PU.1, on the promoter of the type II transforming growth factor-beta receptor gene. RL J. Biol. Chem. 279:19407-20 (2004). RN [8]; RE0048566. RX PUBMED: 15572696. RA Foulds C. E., Nelson M. L., Blaszczak A. G., Graves B. J. RT Ras/mitogen-activated protein kinase signaling activates Ets-1 and Ets-2 by CBP/p300 recruitment. RL Mol. Cell. Biol. 24:10954-10964 (2004). RN [9]; RE0063266. RX PUBMED: 19487701. RA Shi Z., Cai Z., Wen S., Chen C., Gendron C., Sanchez A., Patterson K., Fu S., Yang J., Wildman D. E., Finnell R. H., Zhang D. RT Transcriptional regulation of the novel toll-like receptor TLR13. RL J. Biol. Chem. 284:20540-20547 (2009). XX //