TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02088 XX ID T02088 XX DT 29.01.1997 (created); ewi. DT 29.04.2011 (updated); lat. CO Copyright (C), QIAGEN. XX FA Pbx1b XX SY PBX1; pre B-cell leukemia transcription factor 1b. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G002136 Pbx1. XX HO Exd (Drosophila), MATa1 (yeast), ceh-20 (C. elegans). XX CL C0006; homeo; 3.1.4.4.1.2. XX SZ 347 AA; 38.4 kDa (cDNA) (calc.). XX SQ MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDE SQ AQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGP SQ EKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVM SQ NLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNF SQ NKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQE SQ EANIYAAKTAVTATNVSAHGSQANSPSTPNSAGGYPSPCYQPDRRIQ XX SC edited Swiss-Prot #P41778 XX FT 33 232 PF03792; PBX domain. FT 37 89 Meis-1 cooperativity domain [5]. FT 231 294 PS50071; HOMEOBOX_2. FT 233 298 SM00389; HOX_1. FT 234 293 PF00046; Homeobox domain. XX SF TALE (three amino acid loop extension) homeo domain superclass [3]; SF tissue specific cooperative binding with PKNOX1 T04121 [4]; XX CP widespread [2]. CN lymphoid cells [2]. XX IN T01720 HOXB1; mouse, Mus musculus. IN T03388 meis1-a; mouse, Mus musculus. IN T00545 POU2F1; human, Homo sapiens. XX MX M00096 V$PBX1_01. MX M00124 V$PBX1_02. MX M01357 V$PBX1_04. MX M07451 V$PBX1_10. MX M02028 V$PBX1_Q3. MX M00998 V$PBX_Q3. MX M07304 V$PBX_Q5. XX BS R04429. BS R35085. BS R35086. BS R08497. BS R19539. BS R35078. BS R14770. BS R14768. XX DR TRANSPATH: MO000010773. DR EMBL: L27453; DR UniProtKB: P41778-2; XX RN [1]; RE0005177. RX PUBMED: 7913464. RA Kagawa N., Ogo A., Takahashi Y., Iwamatsu A., Waterman M. R. RT A cAMP-regulatory sequence (CRS1) of CYP17 is a cellular target for the homeodomain protein Pbx1 RL J. Biol. Chem. 269:18716-18719 (1994). RN [2]; RE0005181. RX PUBMED: 1682799. RA Monica K., Saltman D., Nourse J., Galili N., Cleary M. L. RT PBX2 and PBX3, new homeobox genes with extensive homology to the human proto-oncogene PBX1 RL Mol. Cell. Biol. 11:6149-6157 (1991). RN [3]; RE0014544. RX PUBMED: 9336443. RA Burglin T. R. RT Analysis of TALE superclass homeobox genes (MEIS, PBC, KNOX, Iroquois, TGIF) reveals a novel domain conserved between plants and animals RL Nucleic Acids Res. 25:4173-4180 (1997). RN [4]; RE0015494. RX PUBMED: 10381567. RA Ferretti E., Schulz H., Talarico D., Blasi F., Berthelsen J. RT The PBX-regulating protein PREP1 is present in different PBX-complexed forms in mouse RL Mech. Dev. 83:53-64 (1999). RN [5]; RE0015495. RX PUBMED: 9405651. RA Knoepfler P. S., Calvo K. R., Chen H., Antonarakis S. E., Kamps M. P. RT Meis1 and pKnox1 bind DNA cooperatively with Pbx1 utilizing an interaction surface disrupted in oncoprotein E2a-Pbx1 RL Proc. Natl. Acad. Sci. USA 94:14553-14558 (1997). RN [6]; RE0047951. RX PUBMED: 15138251. RA Rave-Harel N., Givens M. L., Nelson S. B., Duong H. A., Coss D., Clark M. E., Hall S. B., Kamps M. P., Mellon P. L. RT TALE homeodomain proteins regulate gonadotropin-releasing hormone gene expression independently and via interactions with Oct-1. RL J. Biol. Chem. 279:30287-30297 (2004). RN [7]; RE0065060. RX PUBMED: 9315626. RA Chang C. P., Jacobs Y., Nakamura T., Jenkins N. A., Copeland N. G., Cleary M. L. RT Meis proteins are major in vivo DNA binding partners for wild-type but not chimeric Pbx proteins. RL Mol. Cell. Biol. 17:5679-5687 (1997). XX //