TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02665 XX ID T02665 XX DT 23.02.1999 (created); ewi. DT 15.07.2005 (updated); ili. CO Copyright (C), QIAGEN. XX FA NK-3 XX SY Bagpipe; BAP; Bgp; NK-3. XX OS fruit fly, Drosophila melanogaster OC eukaryota; animalia; metazoa; arthropoda; insecta; diptera; drosophiloidea; drosophilidae XX GE G018685 bap. XX HO Bapx1 (vertebrates) T02667, T02668. XX CL C0053; NK-2/Nkx. XX SZ 382 AA; 42.0 kDa (calc.). XX SQ MLNMESAGVSAAMAGLSKSLTTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRER SQ SISKSPPLCCRDLGLYKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAA SQ DYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRA SQ AFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEA SQ ALLGASKRVPIQVLVREDGSTTYAHMAAPGAGHGLDPALINIYRHQLQLAYGGLPLPQMQ SQ MPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPVPIPIPGAVRPQRTPCPSPNGQMMS SQ VESGAESVHSAAEDVDENVEID XX SC translated from EMBL #L17133 XX FT 173 233 PS50071; HOMEOBOX_2. FT 175 237 SM00389; HOX_1. FT 176 232 PF00046; Homeobox domain. XX SF NK-2/vnd T04258, NK-3/Bagpipe and NK-4/Tinman T03612 comprise a cluster of homeobox genes and are more closely related to one another (59-66% homology) than to other Drosophila homeo domain factors [1]; XX CP dorsal-most mesodermal cells giving rise to visceral mesoderm of midgut, mesodermal cells of proctodeum and stomodeum developing into visceral mesoderm of hindgut and foregut (stage 10) [2]. XX FF required for normal midgut morphogenesis [2]; FF in the mesodermal cells giving rise to visceral mesoderm of midgut, Bap mRNA disappears during stage 11; FF it persists until late stages of embryogenesis in later hindgut and foregut cells [2]; FF Bap expression is regulated by Tin [2]; XX MX M02329 I$BAP_01. MX M07766 I$BAP_02. XX BS R17507. XX DR TRANSPATH: MO000026641. DR EMBL: L17133; DR EMBL: M27291; DR UniProtKB: P22809; DR FLYBASE: FBgn0004862; bap. XX RN [1]; RE0013335. RX PUBMED: 2573058. RA Kim Y., Nirenberg M. RT Drosophila NK-homeobox genes RL Proc. Natl. Acad. Sci. USA 86:7716-7720 (1989). RN [2]; RE0013336. RX PUBMED: 8101173. RA Azpiazu N., Frasch M. RT tinman and bagpipe: two homeo box genes that determine cell fates in the dorsal mesoderm of Drosophila RL Genes Dev. 7:1325-1340 (1993). XX //