TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T03489 XX ID T03489 XX DT 26.06.2000 (created); rio. DT 05.08.2011 (updated); pos. CO Copyright (C), QIAGEN. XX FA Crx XX SY cone rod homeobox protein. XX OS cattle, Bos taurus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; artiodactyla; ruminantia; pecora; bovidae XX GE G090970 CRX. XX CL C0006; homeo. XX SZ 299 AA; 32.3 kDa (cDNA) (calc.). XX SQ MMAYMNPGPHYSVNALALSGPSVDLMHPAVSYPSAPRKQRRERTTFTRSQLEELEALFAK SQ TQYPDVYAREEVALKINLPESRVQVWFKNRRAKCRQQRQQQKQQQQPPGAQAKARPAKRK SQ AGTSPRSSTDVCPDPLGISDSYSPPLPGPSGSPTTAVATVSIWSPASESPLPEAQRAGLV SQ ASGPSLTSAPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPPLGGPALSPLSGP SQ SVGPSLTQSPTSLSGQSYGTYSPVDSLEFKDPTGTWKFTYNPMDPLDYKDQSAWKFQIL XX SC translated from EMBL #AF154123 XX FT 37 97 PS50071; HOMEOBOX_2. FT 39 95 PS50552; PAX. FT 39 101 SM00389; HOX_1. FT 40 96 PF00046; Homeobox domain. XX SF 96% identity to murine Crx protein and 100% identity to murine Crx homeo domain [1]; XX CP retina, retina pigment epithelium (RPE) [1]. CN brain, heart, liver, muscle, testis [1]. XX IN T17380 FIZ1; cattle, Bos taurus. IN T08326 Sp1; Mammalia. IN T08327 Sp3; Mammalia. IN T10071 sp4; human, Homo sapiens. XX MX M01436 V$CRX_02. MX M00623 V$CRX_Q4. MX M01712 V$CRX_Q4_01. MX M07352 V$CRX_Q4_02. MX M08892 V$CRX_Q6. XX BS R09104. BS R09106. BS R30067. BS R30069. BS R30070. BS R30129. BS R30128. BS R33353. BS R33354. BS R30516. BS R31003. XX DR TRANSPATH: MO000027424. DR EMBL: AF154123; DR UniProtKB: Q9XSK0; XX RN [1]; RE0014673. RX PUBMED: 9390516. RA Chen S., Wang Q. L., Nie Z., Sun H., Lennon G., Copeland N. G., Gilbert D. J., Jenkins N. A., Zack D. J. RT Crx, a novel Otx-like paired-homeodomain protein, binds to and transactivates photoreceptor cell-specific genes RL Neuron 19:1017-1030 (1997). RN [2]; RE0050763. RX PUBMED: 11943774. RA Lerner L. E., Gribanova Y. E., Whitaker L., Knox B. E., Farber D. B. RT The rod cGMP-phosphodiesterase beta-subunit promoter is a specific target for Sp4 and is not activated by other Sp proteins or CRX. RL J. Biol. Chem. 277:25877-25883 (2002). RN [3]; RE0060035. RX PUBMED: 15781457. RA Lerner L. E., Peng G. H., Gribanova Y. E., Chen S., Farber D. B. RT Sp4 is expressed in retinal neurons, activates transcription of photoreceptor-specific genes, and synergizes with Crx. RL J. Biol. Chem. 280:20642-20650 (2005). RN [4]; RE0065614. RX PUBMED: 18854042. RA Mali R. S., Peng G. H., Zhang X., Dang L., Chen S., Mitton K. P. RT FIZ1 is part of the regulatory protein complex on active photoreceptor-specific gene promoters in vivo. RL BMC Mol. Biol. 9:87 (2008). XX //