AC T04192
XX
ID T04192
XX
DT 17.01.2001 (created); rio.
DT 02.11.2012 (updated); mkl.
CO Copyright (C), QIAGEN.
XX
FA Lhx9-isoform1
XX
SY LIM homeobox protein 9.
XX
OS mouse, Mus musculus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G002216 Lhx9.
XX
CL C0025; LIM-homeo; 3.1.5.3.2.2.
XX
SZ 388 AA; 43.0 kDa (cDNA) (calc.).
XX
SQ MLNGTTLEAAMLFHGISGGHIQGIMEEMERRSKTEARLTKGTQLNGRDAGMPPLSPEKPA
SQ LCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFS
SQ VQRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFET
SQ LLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGVDIVNYNSGCNEN
SQ EADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKR
SQ VLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDLTNPT
SQ VTVVTTVISNMDSHEPGSPSQTTLTNLF
XX
SC translated from EMBL #AF134761
XX
FT 60 121 
PS50023; LIM_DOMAIN_2.
FT 61 115 
LIM1 domain [1].
FT 61 114 
SM00132; lim_4.
FT 62 120 
PF00412; LIM domain.
FT 122 184 
PS50023; LIM_DOMAIN_2.
FT 123 177 
SM00132; lim_4.
FT 124 177 
LIM2 domain [1].
FT 124 183 
PF00412; LIM domain.
FT 217 222 
putative nuclearization signal [1].
FT 256 316 
PS50071; HOMEOBOX_2.
FT 257 317 homeo domain [1].
FT 258 320 SM00389; HOX_1.
FT 259 315 PF00046; Homeobox domain.
FT 259 315 PS50558; LIM_HOMEODOMAIN.
XX
SF high similarity to Lhx2 T01969 with main differences in the linker between LIM2 domain and homeo domain [1] [2];
SF Lhx9-isoform1 and Lhx2 T01969 exhibit overlapping expression patterns [1] [2];
SF expression respects neuromeric boundaries, for detailed CNS expression pattern see reference [1];
SF physical interaction with CLIM1a T04193 and CLIM2 T02252 [1] [2];
SF methionine at position 11 may be an alternative translational initiation site [1] [2];
SF splice variant Lhx9-isoform1 alpha T04195 lacks the third helix of the homeo domain [3];
XX
EX amygdaloid body,,,Theiler Stage 22; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX archicortex,,,Theiler Stage 21; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [2].
EX archicortex,,,Theiler Stage 21; high; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX archicortex,,,Theiler Stage 22; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [3].
EX caudal ganglionic eminence (CGE),,,Theiler Stage 22; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [3].
EX cerebellar nuclei,,,Theiler Stage 28; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [2].
EX cerebral cortex,,,Theiler Stage 28; none; RNA-in situ hybridization (non-radioactive); RNA (undefined); [2].
EX cerebral cortex,,,Theiler Stage 28; none; RNA-in situ hybridization (non-radioactive); RNA (undefined); [2].
EX dentate gyrus,,,Theiler Stage 28; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [2].
EX diencephalon,,,Theiler Stage 21; high; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX diencephalon,,,Theiler Stage 22; high; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX eminentia thalami,,,Theiler Stage 22; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [3].
EX epiphysis primordium,,,Theiler Stage 22; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX epithalamus,,,Theiler Stage 21; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [3].
EX epithalamus,,,Theiler Stage 22; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [3].
EX epithalamus,,,Theiler Stage 22; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX epithelium of liver,,,Theiler Stage 19; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX forelimb bud,,,Theiler Stage 16; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX forelimb bud,,,Theiler Stage 17; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [2].
EX gonadal primordium,,,Theiler Stage 19; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX hindlimb bud,,,Theiler Stage 17; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [2].
EX hindlimb bud,,,Theiler Stage 19; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX isocortex,,,Theiler Stage 22; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [3].
EX liver,,,Theiler Stage 19; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX mesencephalon,,,Theiler Stage 21; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [2].
EX olfactory bulb,,,Theiler Stage 21; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX olfactory bulb,,,Theiler Stage 22; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX optic stalk,,,Theiler Stage 23; none; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX pancreas primordium,,,Theiler Stage 19; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX pancreas primordium,,,Theiler Stage 19; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX preoptic area,,,Theiler Stage 23; none; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX preplate of cerebral cortex,superficial cell,,Theiler Stage 21; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [2].
EX pretectal area,,,Theiler Stage 22; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX retina,,,Theiler Stage 21; none; RNA-in situ hybridization (non-radioactive); RNA (undefined); [2].
EX spinal cord,,,Theiler Stage 21; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX subthalamus,,,Theiler Stage 22; none; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX subthalamus,,,Theiler Stage 23; none; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX supraoptic area,,,Theiler Stage 22; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [3].
EX tectum of mesencephalon,,,Theiler Stage 22; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX telencephalic vesicle,,,Theiler Stage 23; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX thalamus,,,Theiler Stage 21; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [2].
EX thalamus,,,Theiler Stage 21; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [3].
EX thalamus,,,Theiler Stage 22; detectable; RNA-in situ hybridization (non-radioactive); RNA (undefined); [3].
EX thalamus,,,Theiler Stage 22; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX thalamus,,,Theiler Stage 23; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
XX
FF may be involved (together with other LIM homeobox factors in combinatorial manner) in the specification of brain subdivisions and the control of neural cell differentiation [1];
FF involved in the specification or function of the pioneer neurons of the cerebral cortex [2];
FF candidate for the dreher (dr) mutation [3];
XX
IN T04193 CLIM1a; mouse, Mus musculus.
IN T02252 CLIM2; mouse, Mus musculus.
XX
MX M01367 V$LHX9_01.
XX
DR TRANSPATH: MO000028085.
DR EMBL: AF134761;
DR UniProtKB: Q9WUH2-1;
XX
RN [1]; RE0015590.
RX PUBMED: 9880598.
RA Retaux S., Rogard M., Bach I., Failli V., Besson M. J.
RT Lhx9: a novel LIM-homeodomain gene expressed in the developing forebrain
RL J. Neurosci. 19:783-793 (1999).
RN [2]; RE0015591.
RX PUBMED: 10330499.
RA Bertuzzi S., Porter F. D., Pitts A., Kumar M., Agulnick A., Wassif C., Westphal H.
RT Characterization of Lhx9, a novel LIM/homeobox gene expressed by the pioneer neurons in the mouse cerebral cortex
RL Mech. Dev. 81:193-198 (1999).
RN [3]; RE0015592.
RX PUBMED: 10756098.
RA Failli V., Rogard M., Mattei M. G., Vernier P., Retaux S.
RT Lhx9 and Lhx9alpha LIM-homeodomain factors: genomic structure, expression patterns, chromosomal localization, and phylogenetic analysis
RL Genomics 64:307-317 (2000).
XX
//