TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09020 XX ID T09020 XX DT 07.06.2006 (created); jag. DT 09.08.2007 (updated); res. CO Copyright (C), QIAGEN. XX FA Mad4 XX SY MAD4; MAX dimerization protein 4. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G006378 Mxd4. XX CL C0012; bHLH-ZIP. XX SZ 209 AA; 23.6 kDa (cDNA) (calc.). XX SQ MELNSLLLLLEAAEYLERRDREAEHGYASMLPFDGDFARKKTKTAGLVRKGPNNRSSHNE SQ LEKHRRAKLRLYLEQLKQLGPLGPDSTRHTTLSLLKRAKMHIKKLEEQDRRALSIKEQLQ SQ REHRFLKRRLEQLSVQSVERVRTDSTGSAVSTDDSEQEVDIEGMEFGPGELDSAGSSSDA SQ DDHYSLQSSGCSDSSYGHPCRRPGCPGLS XX SC SPTREMBL #Q60948 XX FT 6 23 Sin3-interacting domain (SID) [1]. FT 38 106 PS50888; HLH. FT 54 106 PF00010; Helix-loop-helix DNA-binding domain. FT 55 66 basic region [1]. FT 59 111 SM00353; finulus. FT 67 104 helix-loop-helix domain [1]. FT 105 133 leucine zipper (LAL3) [1]. XX FF expression represses transcription especially in combination with Max [1]; FF antagonize transcriptional activities of c-Myc [1]; XX IN T05056 Max; human, Homo sapiens. IN T09085 Max; Mammalia. IN T02397 Sin3A-xbb2; mouse, Mus musculus. IN T09021 Sin3B-isoform1; mouse, Mus musculus. XX DR TRANSPATH: MO000082623. DR EMBL: U32395; DR UniProtKB: Q60948; XX RN [1]; RE0006786. RX PUBMED: 8521822. RA Hurlin P. J., Queva C., Koskinen P. J., Steingrimsson E., Ayer D. E., Copeland N. G., Jenkins N. A., Eisenman R. N. RT Mad3 and Mad4: novel Max-interacting transcriptional repressors that suppress c-myc dependent transformation and are expressed during neural and epidermal differentiation RL EMBO J. 14:5646-5659 (1995). RN [2]; RE0050488. RX PUBMED: 15121849. RA Grinberg A. V., Hu C. D., Kerppola T. K. RT Visualization of Myc/Max/Mad family dimers and the competition for dimerization in living cells. RL Mol. Cell. Biol. 24:4294-4308 (2004). XX //