
AC   T09162
XX
ID   T09162
XX
DT   31.07.2006 (created); res.
DT   29.05.2014 (updated); jtr.
CO   Copyright (C), QIAGEN.
XX
FA   Pax-3
XX
SY   HuP2 (human); mPax-3; mPax3; PAX3.
XX
OS   mouse, Mus musculus
OC   eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE   G006531 Pax3.
XX
CL   C0018; paired-homeo; 3.2.1.1.1.1.
XX
SZ   479 AA; 53.0 kDa (cDNA) (calc.), 56 kDa (SDS) [1]
XX
SQ   MTTLAGAVPRMMRPGPGQNYPRSGFPLEVSTPLGQGRVNQLGGVFINGRPLPNHIRHKIV
SQ   EMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGAIGGSKPKQVTTPDVEKKIEE
SQ   YKRENPGMFSWEIRDKLLKDAVCDRNTVPSVSSISRILRSKFGKGEEEEADLERKEAEES
SQ   EKKAKHSIDGILSERASAPQSDEGSDIDSEPDLPLKRKQRRSRTTFTAEQLEELERAFER
SQ   THYPDIYTREELAQRAKLTEARVQVWFSNRRARWRKQAGANQLMAFNHLIPGGFPPTAMP
SQ   TLPTYQLSEHSYQPTSIPQAVSDPSSTVHRPQPLPPSTVHQSTIPSNADSSSAYCLPSTR
SQ   HGFSSYTDSFVPPSGPSNPMNPTIGNGLSPQVMGLLTNHGGVPHQPQTDYALSPLTGGLE
SQ   PTTTVSASCSQRLEHMKNVDSLPTSQPYCPPTYSTAGYSMDPVTGYQYGQYGQSKPWTF
XX
SC   Swiss-Prot#P24610
XX
FT        1     90   
   transcription inhibiting region [6].
FT       34    159   
   PF00292; 'Paired box' domain.
FT       34    159   
   SM00351; pax3.
FT       34    161   
   PS51057; PAIRED_2.
FT      217    277   
   PS50071; HOMEOBOX_2.
FT      219    275   
   PS50552; PAX.
FT      219    281   
   SM00389; HOX_1.
FT      220    276   
   PF00046; Homeobox domain.
FT      402    479   
   transcription activating region [6].
XX
IN   T11250 Brachyury; mouse, Mus musculus.
IN   T28743 Hp1-gamma; human, Homo sapiens.
IN   T28779 Hp1-gamma; human, Homo sapiens.
IN   T17238 Msx-1; human, Homo sapiens.
IN   T17026 RNF96; human, Homo sapiens.
IN   T08441 Sox-10; rat, Rattus norvegicus.
IN   T25795 TAZ-isoform1; mouse, Mus musculus.
IN   T22859 TAZ; mouse, Mus musculus.
IN   T16161 Tbx15; mouse, Mus musculus.
IN   T11332 Tbx18; mouse, Mus musculus.
IN   T11216 Tbx22-isoform2; human, Homo sapiens.
XX
MX   M00360 V$PAX3_01.
MX   M00327 V$PAX3_B.
MX   M00808 V$PAX_Q6.
XX
BS   R08534.
BS   R08535.
BS   R08536.
BS   R08537.
BS   R08538.
BS   R08539.
BS   R08540.
BS   R08541.
BS   R08542.
BS   R08543.
BS   R08544.
BS   R08545.
BS   R08546.
BS   R08547.
BS   R08548.
BS   R08549.
BS   R08550.
BS   R08551.
BS   R08552.
BS   R08553.
BS   R08554.
BS   R08555.
BS   R08556.
BS   R08557.
BS   R08558.
BS   R08559.
BS   R09451.
BS   R09450.
BS   R02801.
BS   R08678.
BS   R31214.
BS   R33349.
BS   R33350.
BS   R29911.
BS   R62106.
BS   R62109.
BS   R33352.
BS   R34262.
BS   R20677.
BS   R20678.
BS   R20679.
BS   R20681.
BS   R20682.
BS   R20684.
BS   R20685.
XX
DR   TRANSPATH: MO000083953.
DR   EMBL: S66429;
DR   EMBL: S66433;
DR   EMBL: X59358;
DR   UniProtKB: P24610;
XX
RN   [1]; RE0002795.
RX   PUBMED: 2022185.
RA   Goulding M. D., Chalepakis G., Deutsch U., Erselius J. R., Gruss P.
RT   Pax-3, a novel murine DNA binding protein expressed during early neurogenesis
RL   EMBO J. 10:1135-1147 (1991).
RN   [2]; RE0004215.
RX   PUBMED: 8421686.
RA   Epstein D. J., Vogan K. J., Trasler D. G., Gros P.
RT   A mutation within intron 3 of the Pax-3 gene produces aberrantly spliced mRNA transcripts in the splotch (Sp) mouse mutant
RL   Proc. Natl. Acad. Sci. USA 90:532-536 (1993).
RN   [3]; RE0004244.
RX   PUBMED: 8099544.
RA   Maulbecker C. C., Gruss P.
RT   The oncogenic potential of Pax genes
RL   EMBO J. 12:2361-2367 (1993).
RN   [4]; RE0004245.
RX   PUBMED: 7909605.
RA   Chalepakis G., Goulding M., Read A., Strachan T., Gruss P.
RT   Molecular basis of splotch and Waardenburg Pax-3 mutations
RL   Proc. Natl. Acad. Sci. USA 91:3685-3689 (1994).
RN   [5]; RE0004246.
RX   PUBMED: 8065927.
RA   Chalepakis G., Wijnholds J., Gruss P.
RT   Pax-3 - DNA interaction: flexibility in the DNA binding and induction of DNA conformational changes by paired domains
RL   Nucleic Acids Res. 22:3131-3137 (1994).
RN   [6]; RE0004247.
RX   PUBMED: 7809114.
RA   Chalepakis G., Jones F. S., Edelman G. M., Gruss P.
RT   Pax-3 contains domains for transcription activation and transcription inhibition
RL   Proc. Natl. Acad. Sci. USA 91:12745-12749 (1994).
RN   [7]; RE0004248.
RX   PUBMED: 7744814.
RA   Epstein J. A., Lam P., Jepeal L., Maas R. L., Shapiro D. N.
RT   Pax3 inhibits myogenic differentiation of cultured myoblast cells
RL   J. Biol. Chem. 270:11719-11722 (1995).
RN   [8]; RE0004249.
RX   PUBMED: 8162858.
RA   Bober E., Franz T., Arnold H. H., Gruss P., Tremblay P.
RT   Pax-3 is required for the development of limb muscles: a possible role for the migration of dermomyotomal muscle progenitor cells
RL   Development 120:603-612 (1994).
RN   [9]; RE0004250.
RX   PUBMED: 7600971.
RA   Goulding M., Lumsden A., Paquette A. J.
RT   Regulation of Pax-3 expression in the dermomyotome and its role in muscle development
RL   Development 120:957-971 (1994).
RN   [10]; RE0004253.
RX   PUBMED: 1682057.
RA   Epstein D. J., Vekemans M., Gros P.
RT   Splotch (Sp2H), a mutation affecting development of the mouse neural tube, shows a deletion within the paired homeodomain of Pax-3
RL   Cell 67:767-774 (1991).
RN   [11]; RE0004254.
RX   PUBMED: 8406487.
RA   Vogan K. J., Epstein D. J., Trasler D. G., Gros P.
RT   The splotch-delayed (Spd) mouse mutant carries a point mutation within the paired box of the Pax-3 gene
RL   Genomics 17:364-369 (1993).
RN   [12]; RE0006702.
RX   PUBMED: 8929535.
RA   Ericson J., Morton S., Kawakami A., Roelink H., Jessell T. M.
RT   Two critical periods of Sonic Hedgehog signaling required for the specification of motor neuron identity
RL   Cell 87:661-673 (1996).
RN   [13]; RE0007031.
RX   PUBMED: 8633043.
RA   Epstein J. A., Shapiro D. N., Cheng J., Lam P. Y. P., Maas R. L.
RT   Pax3 modulates expression of the c-Met receptor during limb muscle development.
RL   Proc. Natl. Acad. Sci. USA 93:4213-4218 (1996).
RN   [14]; RE0010761.
RX   PUBMED: 7731966.
RA   Underhill D. A., Vogan K. J., Gros P.
RT   Analysis of the mouse Splotch-delayed mutation indicates that the Pax-3 paired domain can influence homeodomain DNA-binding activity
RL   Proc. Natl. Acad. Sci. USA 92:3692-3696 (1995).
RN   [15]; RE0014013.
RX   PUBMED: 7557441.
RA   Chalepakis G., Gruss P.
RT   Identification of DNA recognition sequences for the Pax3 paired domain
RL   Gene 162:267-270 (1995).
RN   [16]; RE0014025.
RX   PUBMED: 9475182.
RA   Reeves F. C., Fredericks W. J., Rauscher F. J. 3rd, Lillycrop K. A.
RT   The DNA binding activity of the paired box transcription factor Pax-3 is rapidly downregulated during neuronal cell differentiation
RL   FEBS Lett. 422:118-122 (1998).
RN   [17]; RE0014075.
RX   PUBMED: 9731536.
RA   Magnaghi P., Roberts C., Lorain S., Lipinski M., Scambler P. J.
RT   HIRA, a mammalian homologue of Saccharomyces cerevisiae transcriptional co-repressors, interacts with Pax3
RL   Nat. Genet. 20:74-77 (1998).
RN   [18]; RE0014085.
RX   PUBMED: 9464541.
RA   Wiggan O., Taniguchi-Sidle A., Hamel P. A.
RT   Interaction of the pRB-family proteins with factors containing paired-like homeodomains
RL   Oncogene 16:227-236 (1998).
RN   [19]; RE0014110.
RX   PUBMED: 8631247.
RA   Daston G., Lamar E., Olivier M., Goulding M.
RT   Pax-3 is necessary for migration but not differentiation of limb muscle precursors in the mouse
RL   Development 122:1017-1027 (1996).
RN   [20]; RE0014112.
RX   PUBMED: 8681797.
RA   Yang X. M., Vogan K., Gros P., Park M.
RT   Expression of the met receptor tyrosine kinase in muscle progenitor cells in somites and limbs is absent in Splotch mice
RL   Development 122:2163-2171 (1996).
RN   [21]; RE0015185.
RX   PUBMED: 7545667.
RA   Kallunki P., Jenkinson S., Edelman G. M., Jones F. S.
RT   Silencer elements modulate the expression of the gene for the neuron-glia cell adhesion molecule, Ng-CAM
RL   J. Biol. Chem. 270:21291-21298 (1995).
RN   [22]; RE0024470.
RX   PUBMED: 12668617.
RA   Lang D., Epstein J. A.
RT   Sox10 and Pax3 physically interact to mediate activation of a conserved c-RET enhancer.
RL   Hum. Mol. Genet. 12:937-945 (2003).
RN   [23]; RE0026514.
RX   PUBMED: 10871843.
RA   Margue C. M., Bernasconi M., Barr F. G., Schafer B. W.
RT   Transcriptional modulation of the anti-apoptotic protein BCL-XL by the paired box transcription factors PAX3 and PAX3/FKHR.
RL   Oncogene 19:2921-9 (2000).
RN   [24]; RE0047961.
RX   PUBMED: 15143176.
RA   Ploski J. E., Shamsher M. K., Radu A.
RT   Paired-type homeodomain transcription factors are imported into the nucleus by karyopherin 13.
RL   Mol. Cell. Biol. 24:4824-4834 (2004).
RN   [25]; RE0047965.
RX   PUBMED: 10748034.
RA   Kovac C. R., Emelyanov A., Singh M., Ashouian N., Birshtein B. K.
RT   BSAP (Pax5)-importin alpha 1 (Rch1) interaction identifies a nuclear localization sequence.
RL   J. Biol. Chem. 275:16752-16757 (2000).
RN   [26]; RE0053016.
RX   PUBMED: 16300735.
RA   Murakami M., Tominaga J., Makita R., Uchijima Y., Kurihara Y., Nakagawa O., Asano T., Kurihara H.
RT   Transcriptional activity of Pax3 is co-activated by TAZ.
RL   Biochem. Biophys. Res. Commun. 339:533-539 (2006).
RN   [27]; RE0064970.
RX   PUBMED: 10529415.
RA   Bendall A. J., Ding J., Hu G., Shen M. M., Abate-Shen C.
RT   Msx1 antagonizes the myogenic activity of Pax3 in migrating limb muscle precursors.
RL   Development 126:4965-4976 (1999).
RN   [28]; RE0065185.
RX   PUBMED: 19458195.
RA   Kumar D., Shadrach J. L., Wagers A. J., Lassar A. B.
RT   Id3 is a direct transcriptional target of Pax7 in quiescent satellite cells.
RL   Mol. Biol. Cell 20:3170-3177 (2009).
RN   [29]; RE0066940.
RX   PUBMED: 17662948.
RA   Boutet S. C., Disatnik M. H., Chan L. S., Iori K., Rando T. A.
RT   Regulation of Pax3 by proteasomal degradation of monoubiquitinated protein in skeletal muscle progenitors.
RL   Cell 130:349-362 (2007).
RN   [30]; RE0066950.
RX   PUBMED: 16945326.
RA   Hsieh M. J., Yao Y. L., Lai I. L., Yang W. M.
RT   Transcriptional repression activity of PAX3 is modulated by competition between corepressor KAP1 and heterochromatin protein 1.
RL   Biochem. Biophys. Res. Commun. 349:573-581 (2006).
RN   [31]; RE0066970.
RX   PUBMED: 18644785.
RA   Farin H. F., Mansouri A., Petry M., Kispert A.
RT   T-box protein Tbx18 interacts with the paired box protein Pax3 in the development of the paraxial mesoderm.
RL   J. Biol. Chem. 283:25372-25380 (2008).
XX
//