TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09934 XX ID T09934 XX DT 21.11.2006 (created); kau. DT 27.03.2008 (updated); dbh. CO Copyright (C), QIAGEN. XX FA Hey2 XX SY basic helix-loop-helix factor 1; CHF1; gridlock; hairy and enhancer of split related-2; hairy-related transcription factor 2; HERP1; Hes-related repressor protein 1; HRT2. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G004060 HEY2; HGNC: Hey2. XX CL C0010; bHLH. XX SZ 337 AA; 35.8 kDa (cDNA) (calc.). XX SQ MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKKRRGIIEKRR SQ RDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMD SQ FMSIGFRECLTEVARYLSSVEGLDSSDPLRVRLVSHLSTCATQREAAAMTSSMAHHHHPL SQ HPHHWAAAFHHLPAALLQPNGLHASESTPCRLSTTSEVPPAHGSALLTATFAHADSALRM SQ PSTGSVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPPNAAAAVAAA SQ TAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGAF XX SC translated from EMBL #AJ249545 XX FT 6 292 PF00478; IMP dehydrogenase / GMP reductase domain. FT 49 61 basic region [1]. FT 49 103 basic helix-loop-helix domain [1]. FT 49 104 PS50888; HLH. FT 51 104 PF00010; Helix-loop-helix DNA-binding domain. FT 54 109 SM00353; finulus. FT 62 103 helix-loop-helix motif [1]. FT 119 166 SM00511; ORANGE. FT 120 164 orange domain [1]. FT 120 166 PF07527; Hairy Orange. FT 122 157 PS51054; ORANGE. FT 327 330 YRPW motif [7]. FT 332 337 conserved motif TE(I/V)GAF [1]. XX IN T01346 arnt-isoform1; human, Homo sapiens. IN T21852 HDAC1; Mammalia. IN T30231 SIRT1-isoform1; human, Homo sapiens. XX MX M08885 V$HAIRYLIKE_Q3. XX BS R12364. BS R10227. XX DR TRANSPATH: MO000092780. DR EMBL: AJ249545; DR UniProtKB: Q9UBP5; XX RN [1]; RE0017655. RX PUBMED: 10588864. RA Nakagawa O., Nakagawa M., Richardson J. A., Olson E. N., Srivastava D. RT HRT1, HRT2, and HRT3: a new subclass of bHLH transcription factors marking specific cardiac, somitic, and pharyngeal arch segments. RL Dev. Biol. 216:72-84 (1999). RN [2]; RE0017656. RX PUBMED: 10860664. RA Steidl C., Leimeister C., Klamt B., Maier M., Nanda I., Dixon M., Clarke R., Schmid M., Gessler M. RT Characterization of the human and mouse HEY1, HEY2, and HEYL genes: cloning, mapping, and mutation screening of a new bHLH gene family RL Genomics 66:195-203 (2000). RN [3]; RE0017667. RX PUBMED: 11095750. RA Nakagawa O., McFadden D. G., Nakagawa M., Yanagisawa H., Hu T., Srivastava D., Olson E. N. RT Members of the HRT family of basic helix-loop-helix proteins act as transcriptional repressors downstream of Notch signaling. RL Proc. Natl. Acad. Sci. USA 97:13655-13660 (2000). RN [4]; RE0042136. RX PUBMED: 12535671. RA Takata T., Ishikawa F. RT Human Sir2-related protein SIRT1 associates with the bHLH repressors HES1 and HEY2 and is involved in HES1- and HEY2-mediated transcriptional repression RL Biochem. Biophys. Res. Commun. 301:250-7 (2003). RN [5]; RE0048851. RX PUBMED: 11486045. RA Iso T., Sartorelli V., Poizat C., Iezzi S., Wu H. Y., Chung G., Kedes L., Hamamori Y. RT HERP, a novel heterodimer partner of HES/E(spl) in Notch signaling. RL Mol. Cell. Biol. 21:6080-6089 (2001). RN [6]; RE0049770. RX PUBMED: 15684393. RA Belandia B., Powell S. M., Garcia-Pedrero J. M., Walker M. M., Bevan C. L., Parker M. G. RT Hey1, a mediator of notch signaling, is an androgen receptor corepressor. RL Mol. Cell. Biol. 25:1425-1436 (2005). RN [7]; RE0017201. RX PUBMED: 10692439. RA Chin M. T., Maemura K., Fukumoto S., Jain M. K., Layne M. D., Watanabe M., Hsieh C. M., Lee M. E. RT Cardiovascular basic helix loop helix factor 1, a novel transcriptional repressor expressed preferentially in the developing and adult cardiovascular system RL J. Biol. Chem. 275:6381-6387 (2000). XX //