TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T10644 XX ID T10644 XX DT 17.07.2007 (created); nta. DT 06.11.2014 (updated); pro. CO Copyright (C), QIAGEN. XX FA MTF-1 XX SY MEP-1; metal element protein-1; metal-regulatory transcription factor 1; MTF-1. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G009179 Mtf1. XX CL C0001; CH. XX SZ 675 AA; 72.6 kDa (cDNA) (calc.), 100 kDa (SDS) [5] XX SQ MGEHSPDDNIIFFKGEEDDLTPHDKMLRFVDDNGLVPSSSGTVYDRTTVLIEQDPGTLED SQ DEDDGQCGEPLPFLVEGEEGFLIDQEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEGA SQ TLTLQSECPETKRKEVKRYQCTFEGCPRTYSTAGNLRTHQKTHRGEYTFVCNQEGCGKAF SQ LTSYSLRIHVRVHTKEKPFECDVQGCEKAFNTLYRLKAHQRLHTGKTFNCESQGCSKYFT SQ TLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRTHTGERPFFCPSNGCEKTFS SQ TQYSLKSHMKGHDNKGTAYSALPQHNGSEDTNHSLYLSELGLLSTDSELQENSSSTQDQD SQ LSTISPAIIFESMFQNSDDPGIQDDPLQTAALIDSFNGDAESVIDVPPPAGNSASLSLPL SQ VLQSGISEPPQPLLPATAPSAPPPAPSLGPGSQPAAFGSPPALLQPPEVPVPHSTQFAAN SQ HQEFLPHPQAPPQTIVPGLSVVAGAPASAATVASAVAAPAPPQSTTEPLPAMVQTLPLGA SQ NSVLTNNPTITITPTPNTAILQSSLVMGEQNLQWILNGATSSPQNQEQIQQASKVEQVYF SQ ATTVPVASGTGSSVQQIGLSVPVIIIKQEEACQCQCACRDSAKERAAGRRKGCSSPPPPE SQ PNPQPPDGPSLQLPP XX SC Swiss-Prot#Q07243 XX FT 25 651 PF00478; IMP dehydrogenase / GMP reductase domain. FT 139 163 PF00096; zf-C2H2. FT 139 163 SM00355; c2h2final6. FT 139 168 PS50157; ZINC_FINGER_C2H2_2. FT 169 193 PF00096; zf-C2H2. FT 169 193 SM00355; c2h2final6. FT 169 198 PS50157; ZINC_FINGER_C2H2_2. FT 199 223 PF00096; zf-C2H2. FT 199 223 SM00355; c2h2final6. FT 199 228 PS50157; ZINC_FINGER_C2H2_2. FT 228 252 PF00096; zf-C2H2. FT 228 252 SM00355; c2h2final6. FT 228 257 PS50157; ZINC_FINGER_C2H2_2. FT 258 282 PF00096; zf-C2H2. FT 258 282 SM00355; c2h2final6. FT 258 287 PS50157; ZINC_FINGER_C2H2_2. FT 288 312 PF00096; zf-C2H2. FT 288 312 SM00355; c2h2final6. FT 288 317 PS50157; ZINC_FINGER_C2H2_2. XX IN T01318 CBP; mouse, Mus musculus. IN T10542 p300; mouse, Mus musculus. IN T00752 Sp1; mouse, Mus musculus. XX MX M01242 V$MTF1_01. MX M01243 V$MTF1_02. MX M02778 V$MTF1_05. MX M00650 V$MTF1_Q4. MX M04619 V$MTF1_Q5. XX BS R04850. BS R04851. BS R64710. BS R01022. BS R29573. BS R21283. BS R21284. XX DR TRANSPATH: MO000110815. DR EMBL: X71327; MMMTF1. DR UniProtKB: Q07243; MTF1_MOUSE. XX RN [1]; RE0000683. RX PUBMED: 3371659. RA Mueller P. R., Salser S. J., Wold B. RT Constitutive and metal-inducible protein: DNA interactions at the mouse metallothionein I promoter examined by in in vivo and in vitro footprinting RL Genes Dev. 2:412-427 (1988). RN [2]; RE0001482. RX PUBMED: 2725504. RA Culotta V. C., Hamer D. H. RT Fine mapping of a mouse metallothionein gene metal response element RL Mol. Cell. Biol. 9:1376-1380 (1989). RN [3]; RE0002180. RX PUBMED: 1870976. RA Labbe S., Prevost J., Remondelli P., Leone A., Seguin C. RT A nuclear factor binds to the metal regulatory elements of the mouse gene encoding metallothionein-I RL Nucleic Acids Res. 19:4225-4231 (1991). RN [4]; RE0006649. RX PUBMED: 8065932. RA Brugnera E., Georgiev O., Radtke F., Heuchel R., Baker E., Sutherland G. R., Schaffner W. RT Cloning, chromosomal mapping and characterization of the human metal-regulatory transcription factor MTF-1 RL Nucleic Acids Res. 22:3167- 3173 (1994). RN [5]; RE0006650. RX PUBMED: 8467794. RA Radtke F., Heuchel R., Georgiev O., Hergersberg M., Gariglio M., Dembic Z., Schaffner W. RT Cloned transcription factor MTF-1 activates the mouse metallothionein I promoter RL EMBO J. 12:1355-1362 (1993). RN [6]; RE0006706. RX PUBMED: 8026472. RA Heuchel R., Radtke F., Georgiev O., Stark G., Aguet M., Schaffner W. RT The transcription factor MTF-1 is essential for basal and heavy metal-induced metallothionein gene expression RL EMBO J. 13:2870-2875 (1994). RN [7]; RE0006723. RX PUBMED: 8108390. RA Palmiter R. D. RT Regulation of metallothionein genes by heavy metals appers to be mediated by a zinc-sensitive inhibitor that interacts with a contstitutively active transcription factor, MTF-1 RL Proc. Natl. Acad. Sci. USA 91:1219- 1223 (1994). RN [8]; RE0006724. RX PUBMED: 7610056. RA Radtke F., Georgiev O., Muller H.-P., Brugnera E., Schaffner W. RT Functional domains of the heavy metal-responsive transcription regulator MTF-1 RL Nucleic Acids Res. 23:2277-2286 (1995). RN [9]; RE0007200. RX PUBMED: 8479904. RA Labbe S., Larouche L., Mailhot D., Seguin C. RT Purification of mouse MEP-1, a nuclear protein which binds to the metal regulatory elements of genes encoding metallothionein RL Nucleic Acids Res. 21:1549-1554 (1993). RN [10]; RE0013733. RX PUBMED: 9582278. RA Guenes C., Heuchel R., Georgiev O., Muller K.-H., Lichtlen P., Bluthmann H., Marino S., Aguzzi A., Schaffner W. RT Embryonic lethality and liver degeneration in mice lacking the metal-responsive transcriptional activator MTF-1. RL EMBO J. 17:2846-2854 (1998). RN [11]; RE0013734. RX PUBMED: 8824273. RA Dalton T. P., Li Q., Bittel D., Liang L., Andrews G. K. RT Oxidative stress activates metal-responsive transcription factor-1 binding activity. Occupancy in vivo of metal response elements in the metallothionein-I gene promoter. RL J. Biol. Chem. 271:26233-26241 (1996). RN [12]; RE0013735. RX PUBMED: 10096565. RA Murphy B. J., Andrews G. K., Bittel D., Discher D. J., McCue J., Green C. J., Yanovsky M., Giaccia A., Sutherland R. M., Laderoute K. R., Webster K. A. RT Activation of metallothionein gene expression by hypoxia involves metal response elements and metal transcription factor-1. RL Cancer Res. 59:1315-1322 (1999). XX //