AC T00790
XX
ID T00790
XX
DT 15.03.1993 (created); ewi.
DT 27.08.2007 (updated); tgo.
CO Copyright (C), QIAGEN.
XX
FA Tal1-PP42
XX
SY pp42-TAL1; SCL; stem-cell leukemia protein; T-cell acute lymphocytic leukemia-1 protein; Tal-1; Tal-1alpha; Tal1; TCL5.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G001188 TAL1; HGNC: TAL1.
XX
CL C0010; bHLH.
XX
SZ 331 AA; 34.3 kDa (cDNA) (calc.).
XX
SQ MTERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAAAEPPVIELGARGGP
SQ GGGPAGGGGAARDLKGRDAATAEARHRVPTTELCRPPGPAPAPAPASVTAELPGDGRMVQ
SQ LSPPALAAPAAPGRALLYSLSQPLASLGSGFFGEPDAFPMFTTNNRVKRRPSPYEMEITD
SQ GPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA
SQ KLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVLSPNSSCGSSLDGAAS
SQ PDSYTEEPAPKHTARSLHPAMLPAADGAGPR
XX
SC Swiss-Prot#P17542-1
XX
FT 117 175 
major trans-activating domain [14].
FT 188 240 
PF00010; Helix-loop-helix DNA-binding domain.
FT 188 240 
PS50888; HLH.
FT 193 245 
SM00353; finulus.
XX
SF N-terminally truncated forms arise from alternative translation initiation at Met-26 (p39) or Met-176 (p22) [12];
SF the eight exons give rise to several splice variants [6];
SF no homodimers, no intrinsic DNA-binding capability, but DNA-binding heterodimers with class A bHLH factors [2] [1];
SF binding sites contain one E-box-like half (AACAG) and one which is contacted by Tal-1 (ATGGT) [2];
SF Tal-1 peptides can be phosphorylated at serine residues [16];
SF multiple trans-activating domains within 1-175 [14];
SF Tal-1 complexes with LIM-proteins Lmo2/RBTN2 in erythroid cells and Lmo1/RBTN1 in T-ALL cells [3] [18];
SF RBTN-interactions depend on an intact bHLH domain and occur simultaneously with E47 heterodimerization [3];
SF specific for the bHLH domains of the Tal-1/Tal-2/Lyl-2 family and for RBTN LIM proteins [3];
XX
CP erythroid cells [13], early hematopoietic tissues, fetal liver [4] [4] [13].
XX
FF activator [14];
FF positive regulator of erythroid differentiation [13];
FF TAL1 gene rearrangements in patients with T-cell acute lymphoblastic leukemia [11];
FF most observed breakpoints are between exons Ia and Ib within the 5'-UTR of the transcribed region [7];
FF after chromosomal translocation or deletion leading to inappropriate expression, it may promoter erythroleukemia [16];
FF a C-terminally truncated variant found in a Jurkat cell subline appears to cause premature apoptosis after serum deprivation [17];
XX
IN T00204 E12; human, Homo sapiens.
IN T00207 E47; human, Homo sapiens.
IN T00674 E47; rat, Rattus norvegicus.
IN T01788 E47; mouse, Mus musculus.
IN T00433 ITF-2; human, Homo sapiens.
IN T02249 LMO1; human, Homo sapiens.
IN T02250 RBTN2-isoform1; human, Homo sapiens.
XX
MX M01034 V$EBOX_Q6_01.
MX M00066 V$TAL1ALPHAE47_01.
MX M00065 V$TAL1BETAE47_01.
MX M00070 V$TAL1BETAITF2_01.
MX M01591 V$TAL1_01.
MX M00993 V$TAL1_Q6.
MX M03804 V$TAL1_Q6_01.
MX M07469 V$TALLIKE_Q6.
XX
BS R04157.
BS R00850.
BS R04158.
XX
DR TRANSPATH: MO000019581.
DR EMBL: M29038; HSSCL.
DR EMBL: M61103; HSSCL1.
DR EMBL: M61104; HSSCL2.
DR EMBL: M61105; HSSCL3.
DR EMBL: M61108; HSSCLA.
DR EMBL: M63572; HSSCL4.
DR EMBL: M63576; HSSCL5.
DR EMBL: M63584; HSSCL6.
DR EMBL: M63589; HSSCL7.
DR EMBL: X51990; HSTAL1AA.
DR EMBL: X58621; HSTAL1D.
DR EMBL: X58622; HSTAL1E.
DR UniProtKB: P17542-1; SCL_HUMAN.
XX
RN [1]; RE0001629.
RX PUBMED: 2038315.
RA Hsu H.-L., Cheng J.-T., Chen Q., Baer R.
RT Enhancer-binding activity of the tal-1 oncoprotein in association with the E47/E12 helix-loop-helix proteins
RL Mol. Cell. Biol. 11:3037-3042 (1991).
RN [2]; RE0002932.
RX PUBMED: 8289805.
RA Hsu H.-L., Huang L., Tsan J. T., Funk W., Wright W. E., Hu J.-S., Kingston R. E., Baer R.
RT Preferred sequences for DNA recognition by the TAL1 helix-loop-helix proteins
RL Mol. Cell. Biol. 14:1256-1265 (1994).
RN [3]; RE0003640.
RX PUBMED: 7957052.
RA Wadman I., Li J., Bash R. O., Forster A., Osada H., Rabbitts T. H., Baer R.
RT Specific in vivo association between the bHLH and LIM proteins implicated in human T cell leukemia
RL EMBO J. 13:4831-4839 (1994).
RN [4]; RE0004028.
RX PUBMED: 2602361.
RA Begley C. G., Aplan P. D., Denning S. M., Haynes B. F., Waldmann T. A., Kirsch I. R.
RT The gene SCL is expressed during early hematopiesis and encodes a differentiation-related DNA-binding motif
RL Proc. Natl. Acad. Sci. USA 86:10128-10132 (1989).
RN [5]; RE0004029.
RX PUBMED: 2303035.
RA Chen Q., Cheng J. T., Tsai L. H., Schneider N., Buchanan G., Carroll A., Crist W., Ozanne B., Siciliano M. J., Baer R.
RT The tal gene undergoes chromosome translocation in T cell leukemia and potentially encodes a helix-loop-helix protein
RL EMBO J. 9:415-424 (1990).
RN [6]; RE0004030.
RX PUBMED: 2247063.
RA Aplan P. D., Begley C. G., Bertness V., Nussmeier M., Ezquerra A., Coligan J., Kirsch I. R.
RT The SCL gene is formed from a transcriptionally complex locus
RL Mol. Cell. Biol. 10:6426-6435 (1990).
RN [7]; RE0004031.
RX PUBMED: 2230650.
RA Chen Q., Yang C. Y. C., Tsan J. T., Xia Y., Ragab A. H., Peiper S. C., Carroll A., Baer R.
RT Coding sequences of the tal-1 gene are disrupted by chromosome translocation in human T cell leukemia
RL J. Exp. Med. 172:1403-1408 (1990).
RN [8]; RE0004034.
RX PUBMED: 2467296.
RA Begley C. G., Aplan P. D., Davey M. P., Nakahara K., Tchorz K., Kurtzberg J., Hershfield M., Haynes B. F., Cohen D. I., Waldmann T. A., Kirsch I. R.
RT Chromosomal translocation in a human leukemic stem-cell line disrupts the T-cell antigen receptor delta-chain diversity region and results in a previously unreported fusion transcript
RL Proc. Natl. Acad. Sci. USA 86:2031-2035 (1989).
RN [9]; RE0004035.
RX PUBMED: 1311214.
RA Aplan P. D., Lombardi D. P., Reaman G. H., Sather H. N., Hammond G. D., Kirsch I. R.
RT Involvement of the putative hematopoitic transcription factor SCL in T-cell acute lymphoblastic leukemia
RL Blood 79:1327-1333 (1992).
RN [10]; RE0004036.
RX PUBMED: 2255914.
RA Aplan P. D., Lombardi D. P., Ginsberg A. M., Cossman J., Bertness V. L., Kirsch I. R.
RT Disruption of the human SCL locus by 'illegitime' V(D)J recombinase activity
RL Science 250:1426-1429 (1990).
RN [11]; RE0004037.
RX PUBMED: 2209547.
RA Brown L., Cheng J.-T., Chen Q., Siciliano M. J., Christ W., Buchanan G., Baer R.
RT Site-specific recombination of the tal-1 gene is a common occurence in human T cell leukemia
RL EMBO J. 9:3343-3351 (1990).
RN [12]; RE0004038.
RX PUBMED: 8223432.
RA Whitelaw M. L., Goettlicher M., Gustafsson J. A., Poelinger L.
RT Definition of a novel ligand binding domain of a nuclear bHLH receptor: co-localization of ligand and hsp90 binding activities within the regulable inactivation domain of the dioxin receptor
RL EMBO J. 12:4169-4179 (1993).
RN [13]; RE0004039.
RX PUBMED: 8065918.
RA Carver L. A., Hogenesch J. B., Bradfield C. A.
RT Tissue specific expression of the rat Ah-receptor and ARNT mRNAs
RL Nucleic Acids Res. 22:3038-3044 (1994).
RN [14]; RE0004040.
RX PUBMED: 8065302.
RA Reick M., Robertson R. W., Pasco D. S., Fagan J. B.
RT Down-regulation of nuclear aryl hydrocarbon receptor DNA-binding and transactivation functions: requirement for a labile or inducible factor
RL Mol. Cell. Biol. 14:5653-5660 (1994).
RN [15]; RE0004042.
RX PUBMED: 3588289.
RA Fujisawa-Sehara A., Sogawa K., Yamane M., Fuji-Kurijama Y.
RT Characterization of xenobiotic response elements upstream from the drug-metabolizing cytochrome P450c gene: a similarity to glucocorticoid regulatoty elements
RL Nucleic Acids Res. 15:4179-4191 (1987).
RN [16]; RE0004043.
RX PUBMED: 1325649.
RA Burbach K. M., Poland A., Bradfield C. A.
RT Cloning of the Ah-receptor cDNA reveals a distinctive-ligand-activated transcription factor
RL Proc. Natl. Acad. Sci. USA 89:8185-8189 (1992).
RN [17]; RE0005821.
RX PUBMED: 7774592.
RA Leroy-Viard K., Vinit M.-A., Lecointe N., Jouault H., Hibner U., Romeo P.-H., Mathieu-Mahul D.
RT Loss of TAL-1 protein activity induces premature apoptosis of Jurkat leukemic T cells upon medium depletion
RL EMBO J. 14:2341-2349 (1995).
RN [18]; RE0006083.
RX PUBMED: 8078932.
RA Valge-Archer V. E., Osada H., Warren A. J., Forster A., Li J., Baer R., Rabbitts T. H.
RT The LIM protein RBTN2 and the basic helix-loop-helix protein TAL1 are present in a complex in erythroid cells
RL Proc. Natl. Acad. Sci. USA 91:8617-8621 (1994).
RN [19]; RE0049147.
RX PUBMED: 15930267.
RA Palamarchuk A., Efanov A., Maximov V., Aqeilan R. I., Croce C. M., Pekarsky Y.
RT Akt phosphorylates Tal1 oncoprotein and inhibits its repressor activity.
RL Cancer Res. 65:4515-4519 (2005).
XX
//