TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02250 XX ID T02250 XX DT 29.10.1997 (created); ewi. DT 24.09.2008 (updated); pwa. CO Copyright (C), QIAGEN. XX FA RBTN2-isoform1 XX SY LIM-only protein 2; LMO2a; RBTN2; Rhombotin-2; TTG-2. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G004692 LMO2; HGNC: LMO2. XX CL C0028; LIM. XX SZ 158 AA; 18.4 kDa (cDNA) (calc.). XX SQ MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLC SQ GCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECF SQ KCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI XX SC Swiss-Prot#P25791-1 XX FT 28 90 PS50023; LIM_DOMAIN_2. FT 29 83 SM00132; lim_4. FT 30 89 PF00412; LIM domain. FT 92 154 PS50023; LIM_DOMAIN_2. FT 93 147 SM00132; lim_4. FT 94 153 PF00412; LIM domain. XX SF specifically interacts with Tal-1 in erythroid cells [1] [3]; XX FF associated with t(11; FF 14)(p13; FF q11) translocations in T cell leukemias [4]; FF essential for erythroid differentiation [4]; XX IN T02252 CLIM2; mouse, Mus musculus. IN T01632 Lyl-1; human, Homo sapiens. IN T00722 pRb; human, Homo sapiens. IN T01799 Tal-1; mouse, Mus musculus. IN T00790 Tal1-PP42; human, Homo sapiens. XX DR TRANSPATH: MO000026257. DR EMBL: X61118; DR UniProtKB: P25791-1; XX RN [1]; RE0003640. RX PUBMED: 7957052. RA Wadman I., Li J., Bash R. O., Forster A., Osada H., Rabbitts T. H., Baer R. RT Specific in vivo association between the bHLH and LIM proteins implicated in human T cell leukemia RL EMBO J. 13:4831-4839 (1994). RN [2]; RE0006078. RX PUBMED: 1923511. RA Royer-Pokora B., Loos L., Ludwig W. D. RT TTG-2 a new gene encoding a cyseine rich protein with the LIM motif, is overexpressed in acute T-cell leukaemia with t(11;14) (p13;q11) RL Oncogene 6:1887-1893 (1991). RN [3]; RE0006083. RX PUBMED: 8078932. RA Valge-Archer V. E., Osada H., Warren A. J., Forster A., Li J., Baer R., Rabbitts T. H. RT The LIM protein RBTN2 and the basic helix-loop-helix protein TAL1 are present in a complex in erythroid cells RL Proc. Natl. Acad. Sci. USA 91:8617-8621 (1994). RN [4]; RE0006590. RX PUBMED: 7568177. RA Osada H., Grutz G., Axelson H., Forster A., Rabbitts T. H. RT Association of erythroid transcription factors: Complexes involving the LIM protein RBTN2 and the zinc finger protein GATA1 RL Proc. Natl. Acad. Sci. USA 92:9585-9589 (1995). XX //