AC T01573
XX
ID T01573
XX
DT 24.11.1995 (created); ewi.
DT 12.06.2014 (updated); spk.
CO Copyright (C), QIAGEN.
XX
FA STAT1beta
XX
SY GAF; ISGF3alpha p84; STAT84.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G004625 STAT1; HGNC: STAT1.
XX
CL C0039; STAT; 6.2.1.0.1.2.
XX
SZ 712 AA; 83.0 kDa (cDNA) (calc.), 84 kDa (SDS)
XX
SQ MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
SQ LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQ
SQ RFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNR
SQ EHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWK
SQ RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQV
SQ LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
SQ KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
SQ EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
SQ PRNLSFFLTPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWT
SQ RFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFL
SQ LRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
SQ ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEV
XX
SC edited Swiss-Prot #P42224
XX
FT 2 122 
PF02865; STAT protein, protein interaction domain.
FT 69 374 
PF00478; IMP dehydrogenase / GMP reductase domain.
FT 136 315 
PF01017; STAT protein, all-alpha domain.
FT 317 567 
PF02864; STAT protein, DNA binding domain.
FT 403 508 
DNA-binding specificty determining domain [5].
FT 573 651 
PF00017; SH2 domain.
FT 573 670 
PS50001; SH2.
XX
SF tyrosine-phosphorylation;
SF subunit of ISGF-3alpha;
SF gene comprises 24 exons, exon 22 provides the stop codon of STAT1beta [6];
SF the same gene encodes STAT1alpha [6];
SF dimerization of the phosphorylated form through SH2 and phosphotyrosine [14];
SF DNA-binding domain is predicted to comprise an alpha-helix and a beta-sheet [5];
XX
FF mediates transduction of tyrosine phosphorylation signals to induction of interferon-stimulated gene expression [3];
FF most likely identical with or related to SIF (c-sis-inducible factor) [11] [15] [1];
FF inducible by IFN-alpha and IFN-gamma [2] [3] [8] [10];
FF inducible by growth factors and hormones [13];
FF Tyr-phosphorylation promotes formation of ISGF3 complex and its nuclear translocation [3] [9];
XX
IN T04074 brca1; human, Homo sapiens.
IN T34781 ErbB1; human, Homo sapiens.
IN T01492 STAT1alpha; human, Homo sapiens.
IN T01575 STAT1alpha; mouse, Mus musculus.
IN T01494 STAT2; human, Homo sapiens.
XX
MX M00224 V$STAT1_01.
MX M00492 V$STAT1_02.
MX M00496 V$STAT1_03.
MX M07064 V$STAT1_Q4.
MX M01823 V$STAT1_Q6.
MX M00223 V$STAT_01.
MX M00777 V$STAT_Q6.
XX
BS R14657.
BS R14658.
BS R04223.
BS R14714.
BS R04650.
BS R04651.
XX
DR TRANSPATH: MO000019505.
DR EMBL: M97936; HSISGF3B.
DR UniProtKB: P42224-2;
XX
RN [1]; RE0000446.
RX PUBMED: 1901265.
RA Decker T., Lew D. J., Mirkowitch J., Darnell J. E.
RT Cytoplasmic activation of GAF, an IFN-gamma-regulated DNA-binding factor
RL EMBO J. 10:927-932 (1991).
RN [2]; RE0002946.
RX PUBMED: 1280824.
RA Gutch M. J., Daly C., Reich N. C.
RT Tyrosine phosphorylation is required for activation of an alpha interferon-stimulated transcription factor
RL Proc. Natl. Acad. Sci. USA 89:11411-11415 (1992).
RN [3]; RE0003478.
RX PUBMED: 1638633.
RA Fu X.-Y.
RT A transcription factor with SH2 and SH3 domains is directly activated by an interferon alpha-induced cytoplasmic protein tyrosine kinase(s)
RL Cell 70:323-335 (1992).
RN [4]; RE0003479.
RX PUBMED: 7680098.
RA Igarashi K., David M., Finbloom D., Larner A. C.
RT In vitro activation of the transcription factor gamma interferon activation factor by gamma interferon: evidence for a tyrosine phosphatase/kinase signalling cascade
RL Mol. Cell. Biol. 13:1634- 1640 (1993).
RN [5]; RE0003481.
RX PUBMED: 7774815.
RA Horvath C. M., Wen Z., Darnell jr J. E.
RT A STAT protein domain that determines DNA sequence recognition suggests a novel DNA-binding domain
RL Genes Dev. 9:984-994 (1995).
RN [6]; RE0003482.
RX PUBMED: 7885841.
RA Yan R., Qureshi S., Zhong Z., Wen Z., Darnell jr J. E.
RT The genomic structure of the STAT genes: multiple exons in coincident sites in Stat1 and Stat2
RL Nucleic Acids Res. 23:459-463 (1995).
RN [7]; RE0003489.
RX PUBMED: 1502203.
RA Schindler C., Fu X.-Y., Improta T., Aebersold R., Darnell J. E.
RT Protein of ISGF3: One gene encodes the 91-and 84-kDa ISGF-3 proteins that are activated by interferon alpha
RL Proc. Natl. Acad. Sci. USA 89:7836-7839 (1992).
RN [8]; RE0003490.
RX PUBMED: 1496401.
RA Schindler C., Shuai K., Prezioso V. R., Darnell J. E.
RT Interferon-dependent tyrosine phosphorylation of a latent cytoplasmic transcription factor
RL Science 257:809-813 (1992).
RN [9]; RE0003491.
RX PUBMED: 1281555.
RA Shuai K., Schindler C., Prezioso V. R., Darnell J. E.
RT Activation of transcription by IFN-gamma tyrosine phosphorylation of a 91-kDa DNA binding protein
RL Science 258:1808-1812 (1992).
RN [10]; RE0003492.
RX PUBMED: 7688129.
RA Khan K. D., Shuai K., Lindwall G., Maher S. E., Darnell J. E., Bothwell A. L. M.
RT Induction of the Ly-6A/E gene by interferon alpha/beta and gamma requires a DNA element to which a tyrosine phosphorylated 91-kDa protein binds
RL Proc. Natl. Acad. Sci. USA 90:6806-6810 (1993).
RN [11]; RE0003495.
RX PUBMED: 7504784.
RA Shuai K., Ziemiecki A., Wilks A. F., Harpur A. G., Sadowski H. B., Gilman M. Z., Darnell J. E.
RT Polypeptide signalling to the nucleus through tyrosine phosphorylation of Jak and Stat proteins
RL Nature 366:580-583 (1993).
RN [12]; RE0003496.
RX PUBMED: 7690989.
RA Shuai K., Stark G. R., Kerr I. M., Darnell J. E.
RT A single phosphotyrosine residue of Stat91 required for gene activation by interferon-gamma
RL Science 261:1744-1746 (1993).
RN [13]; RE0003499.
RX PUBMED: 8397445.
RA Sadowski H. B., Shuai K., Darnell J. E., Gilman M. Z.
RT A common nuclear signal transduction pathway activated by growth factor and cytokine receptors
RL Science 261:1739-1744 (1993).
RN [14]; RE0003505.
RX PUBMED: 7510216.
RA Shuai K., Horvath C. M., Huang L. H. T., Qureshi S. A., Cowburn D., Darnell J. E.
RT Interferon activation of the transcription factor Stat91 involves dimerization through SH2-phosphotyrosyl peptide interactions
RL Cell 76:821-828 (1994).
RN [15]; RE0003523.
RX PUBMED: 8321202.
RA Kanno Y., Kozak C. A., Schindler C., Driggers P. H., Ennist D. L., Gleason S. L., Darnell J. E., Ozato K.
RT The genomic structure of the murine ICSBP gene reveals the presence of the gamma-interferon-responsive element, to which an ISGF3alpha subunit (or similar) molecule binds
RL Mol. Cell. Biol. 13:3951-3963 (1993).
RN [16]; RE0017512.
RX PUBMED: 10792030.
RA Ouchi T., Lee S. W., Ouchi M., Aaronson S. A., Horvath C. M.
RT Collaboration of signal transducer and activator of transcription 1 (STAT1) and BRCA1 in differential regulation of IFN-gamma target genes.
RL Proc. Natl. Acad. Sci. USA 97:5208-5213 (2000).
RN [17]; RE0026427.
RX PUBMED: 10748192.
RA Gamero A. M., Larner A. C.
RT Signaling via the T cell antigen receptor induces phosphorylation of stat1 on serine 727
RL J. Biol. Chem. 275:16574-8 (2000).
RN [18]; RE0027727.
RX PUBMED: 10558875.
RA Runge D. M., Runge D., Foth H., Strom S. C., Michalopoulos G. K.
RT STAT 1alpha/1beta, STAT 3 and STAT 5: expression and association with c-MET and EGF-receptor in long-term cultures of human hepatocytes.
RL Biochem. Biophys. Res. Commun. 265:376-81 (1999).
RN [19]; RE0033178.
RX PUBMED: 14645718.
RA Nusinzon I., Horvath C. M.
RT Interferon-stimulated transcription and innate antiviral immunity require deacetylase activity and histone deacetylase 1.
RL Proc. Natl. Acad. Sci. USA 100:14742-7 (2003).
RN [20]; RE0049934.
RX PUBMED: 15825084.
RA Lin W., Choe W. H., Hiasa Y., Kamegaya Y., Blackard J. T., Schmidt E. V., Chung R. T.
RT Hepatitis C virus expression suppresses interferon signaling by degrading STAT1.
RL Gastroenterology 128:1034-1041 (2005).
RN [21]; RE0055106.
RX PUBMED: 18635538.
RA Kubota T., Matsuoka M., Chang T. H., Tailor P., Sasaki T., Tashiro M., Kato A., Ozato K.
RT Virus infection triggers SUMOylation of IRF3 and IRF7, leading to the negative regulation of type I interferon gene expression.
RL J. Biol. Chem. 283:25660-25670 (2008).
RN [22]; RE0068847.
RX PUBMED: 15850793.
RA Brand S., Zitzmann K., Dambacher J., Beigel F., Olszak T., Vlotides G., Eichhorst S. T., Goke B., Diepolder H., Auernhammer C. J.
RT SOCS-1 inhibits expression of the antiviral proteins 2',5'-OAS and MxA induced by the novel interferon-lambdas IL-28A and IL-29.
RL Biochem. Biophys. Res. Commun. 331:543-548 (2005).
RN [23]; RE0070000.
RX PUBMED: 12517937.
RA Dondi E., Rogge L., Lutfalla G., Uze G., Pellegrini S.
RT Down-modulation of responses to type I IFN upon T cell activation.
RL J. Immunol. 170:749-756 (2003).
XX
//