TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01575 XX ID T01575 XX DT 24.11.1995 (created); ewi. DT 27.02.2014 (updated); prb. CO Copyright (C), QIAGEN. XX FA STAT1alpha XX SY ISGF3alpha p91; signal transducer and activator of transcription 1; Signal Transducer and Activator of Transcription 1 p91; STAT1; STAT91. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G006765 Stat1. XX CL C0039; STAT; 6.2.1.0.1.1. XX SZ 749 AA; 87.2 kDa (cDNA) (calc.), 91 kDa (SDS) XX SQ MSQWFELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAAYDVSFATIRFHDL SQ LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPVQMSMIIYNCLKEERKILENAQ SQ RFNQAQEGNIQNTVMLDKQKELDSKVRNVKDQVMCIEQEIKTLEELQDEYDFKCKTSQNR SQ EGEANGVAKSDQKQEQLLLHKMFLMLDNKRKEIIHKIRELLNSIELTQNTLINDELVEWK SQ RRQQSACIGGPPNACLDQLQTWFTIVAETLQQIRQQLKKLEELEQKFTYEPDPITKNKQV SQ LSDRTFLLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKSRLLVKLQESNLLTKV SQ KCHFDKDVNEKNTVKGFRKFNILGTHTKVMNMEESTNGSLAAELRHLQLKEQKNAGNRTN SQ EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVTE SQ PRNLSFFLNPPCAWWSQLSEVLSWQFSSVTKRGLNADQLSMLGEKLLGPNAGPDGLIPWT SQ RFCKENINDKNFSFWPWIDTILELIKNDLLCLWNDGCIMGFISKERERALLKDQQPGTFL SQ LRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP SQ ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDDPKRTGYIKTELISVSEVHPSRLQTT SQ DNLLPMSPEEFDEMSRIVGPEFDSMMSTV XX SC Swiss-Prot#P42225 XX FT 2 122 PF02865; STAT protein, protein interaction domain. FT 69 423 PF00478; IMP dehydrogenase / GMP reductase domain. FT 136 315 PF01017; STAT protein, all-alpha domain. FT 317 567 PF02864; STAT protein, DNA binding domain. FT 573 651 PF00017; SH2 domain. FT 573 670 PS50001; SH2. XX SF tyrosine-phosphorylation; SF subunit of ISGF-3alpha; SF forms homodimers; SF forms heterodimers with STAT3; XX CP Bone marrow derived macrophages treated with CSF [17]. XX FF activator of a number of genes; FF homodimer may act as a repressor [11]; FF mediates transduction of tyrosine phosphorylation signals to induction of interferon-stimulated gene expression [2]; FF most likely identical with SIF (c-sis-inducible factor) [3]; FF inducible by IFN-alpha and IFN-gamma [1]; FF inducible by CSF-1 and other cytokines, growth factors and hormones [10] [2] [4] [7]; FF not induced by IL-6 [7]; FF Tyr-phosphorylation promotes formation of ISGF3 complex, nuclear translocation, DNA-binding and trans-activation [1]; FF Stat1 Tyr-phosphorylation depends on phosphorylation of Stat2 [9]; FF modifying protein kinases are Jak1 (triggered by IFN-alpha and -gamma) and Jak2 (responding to IFN-gamma) [1]; FF is activated by IL-10 and IFNgamma [12]; XX IN T01492 STAT1alpha; human, Homo sapiens. IN T01575 STAT1alpha; mouse, Mus musculus. IN T01573 STAT1beta; human, Homo sapiens. IN T01494 STAT2; human, Homo sapiens. IN T01574 STAT3; mouse, Mus musculus. IN T00824 TFII-I; human, Homo sapiens. XX MX M00224 V$STAT1_01. MX M00492 V$STAT1_02. MX M00496 V$STAT1_03. MX M07064 V$STAT1_Q4. MX M01823 V$STAT1_Q6. MX M00223 V$STAT_01. MX M00777 V$STAT_Q6. XX BS R14619. BS R14236. BS R14547. BS R25433. BS R11115. BS R08485. BS R04223. BS R13215. BS R13574. BS R14495. BS R13151. BS R17088. BS R17089. BS R04650. BS R04651. XX DR TRANSPATH: MO000013118. DR TRANSCOMPEL: C00192. DR TRANSCOMPEL: C00301. DR TRANSCOMPEL: C00391. DR EMBL: U06924; DR UniProtKB: P42225; XX RN [1]; RE0003494. RX PUBMED: 7504785. RA Silvennoinen O., Ihle J. N., Schlessinger J., Levy D. E. RT Interferon-induced nuclear signalling by Jak protein tyrosine kinases RL Nature 366:583-585 (1993). RN [2]; RE0003498. RX PUBMED: 8378775. RA Silvennoinen O., Schindler C., Schlessinger J., Levy D. E. RT Ras-independent growth factor signaling by transcription factor tyrosine phosphorylation RL Science 261:1736-1744 (1993). RN [3]; RE0003500. RX PUBMED: 8378774. RA Ruff-Jamison S., Chen K., Cohen S. RT Induction by EGF and interferon-gamma of tyrosine phosphorylated DNA binding proteins in mouse liver RL Science 261:1733-1736 (1993). RN [4]; RE0003501. RX PUBMED: 7518927. RA David M., Petricoin III E. F., Igarashi K.-I., Feldman G. M., Finbloom D. S., Larner A. C. RT Prolactin activates the interferon-regulated p91 transcription factor and the Jak2 kinase by tyrosine phosphorylation RL Proc. Natl. Acad. Sci. USA 91:7174-7178 (1994). RN [5]; RE0003503. RX PUBMED: 8140422. RA Zhong Z., Wen Z., Darnell J. E. RT Stat3: a STAT family member activated by tyrosine phosphorylation in response to epidermal growth factor and interleukin-6 RL Science 264:95-98 (1994). RN [6]; RE0003504. RX PUBMED: 7545930. RA Zhong Z., Wen Z., Darnell J. E. RT Stat3 and Stat4: members of the family of signal transducers and activators of transcription RL Proc. Natl. Acad. Sci. USA 91:4806-4810 (1994). RN [7]; RE0003506. RX PUBMED: 7512451. RA Akira S., Nishio Y., Inoue M., Wang X. J., Shi W., Matsusaka T., Yoshida K., Sudo T., Naruto M., Kishimoto T. RT Molecular cloning of APRF, a novel IFN-stimulated gene factor 3 p91-related transcription factor involved in the gp130-mediated signaling pathway RL Cell 77:63-71 (1994). RN [8]; RE0003523. RX PUBMED: 8321202. RA Kanno Y., Kozak C. A., Schindler C., Driggers P. H., Ennist D. L., Gleason S. L., Darnell J. E., Ozato K. RT The genomic structure of the murine ICSBP gene reveals the presence of the gamma-interferon-responsive element, to which an ISGF3alpha subunit (or similar) molecule binds RL Mol. Cell. Biol. 13:3951-3963 (1993). RN [9]; RE0003816. RX PUBMED: 8524306. RA Qureshi S. A., Leung S., Kerr I. M., Stark G. R., Darnell jr J. E. RT Function of Stat2 protein in transcriptional activation by alpha interferon RL Mol. Cell. Biol. 16:288-293 (1996). RN [10]; RE0011175. RX PUBMED: 7588632. RA Hill C. S., Treisman R. RT Differential activation of c-fos promoter elements by serum, lysophosphatidic acid, G proteins and polypeptide growth factors RL EMBO J. 14:5037-5047 (1995). RN [11]; RE0018204. RX PUBMED: 11554754. RA Hogan J. C., Stephens J. M. RT The identification and characterization of a STAT 1 binding site in the PPARgamma2 promoter. RL Biochem. Biophys. Res. Commun. 287:484-492 (2001). RN [12]; RE0023360. RX PUBMED: 8830676. RA Wehinger J., Gouilleux F., Groner B., Finke J., Mertelsmann R., Weber-Nordt R. M. RT IL-10 induces DNA binding activity of three STAT proteins (Stat1, Stat3, and Stat5) and their distinct combinatorial assembly in the promoters of selected genes. RL FEBS Lett. 394:365-370 (1996). RN [13]; RE0038539. RX PUBMED: 10975815. RA Delgado M., Ganea D. RT Inhibition of IFN-gamma-induced janus kinase-1-STAT1 activation in macrophages by vasoactive intestinal peptide and pituitary adenylate cyclase-activating polypeptide RL J. Immunol. 165:3051-7 (2000). RN [14]; RE0053468. RX PUBMED: 15619518. RA Bhardwaj N., Rosas L. E., Lafuse W. P., Satoskar A. R. RT Leishmania inhibits STAT1-mediated IFN-gamma signaling in macrophages: increased tyrosine phosphorylation of dominant negative STAT1beta by Leishmania mexicana. RL Int. J. Parasitol. 35:75-82 (2005). RN [15]; RE0053543. RX PUBMED: 10940917. RA Mattner J., Schindler H., Diefenbach A., Rollinghoff M., Gresser I., Bogdan C. RT Regulation of type 2 nitric oxide synthase by type 1 interferons in macrophages infected with Leishmania major. RL Eur. J. Immunol. 30:2257-2267 (2000). RN [16]; RE0064202. RX PUBMED: 19197936. RA Kar S., Ukil A., Das P. K. RT Signaling events leading to the curative effect of cystatin on experimental visceral leishmaniasis: involvement of ERK1/2, NF-kappaB and JAK/STAT pathways. RL Eur. J. Immunol. 39:741-751 (2009). RN [17]; RE0052744. RX PUBMED: 9292509. RA Feldman G. M., Rosenthal L. A., Liu X., Hayes M. P., Wynshaw-Boris A., Leonard W. J., Hennighausen L., Finbloom D. S. RT STAT5A-deficient mice demonstrate a defect in granulocyte-macrophage colony-stimulating factor-induced proliferation and gene expression. RL Blood 90:1768-1776 (1997). XX //