TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01710 XX ID T01710 XX DT 06.03.1996 (created); ewi. DT 11.12.2014 (updated); asv. CO Copyright (C), QIAGEN. XX FA hoxa9 XX SY D6a9; homeo box A9; Hox-1.7; Hoxa-9; HOXA9; XhoxB1 (Xenopus). XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G014360 Hoxa9. XX HO Abd-B (Drosophila). XX CL C0006; homeo. XX SZ 271 AA; 29.9 kDa (cDNA) (calc.). XX SQ MATTGALGNYYVDSFLLGADAADELGAGRYAPGTLGQPPRQAAALAEHPDFSPCSFQSKA SQ AVFGASWNPVHAAGANAVPAAVYHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSF SQ AGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNAE SQ NESGGDKPPIDPNNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVAR SQ LLNLTERQVKIWFQNRRMKMKKINKDRAKDE XX SC translated from EMBL #AB005457 XX FT 1 61 Meis-1 T03388 T03389 interaction domain [3]. FT 1 192 PF04617; Hox9 activation region. FT 203 263 PS50071; HOMEOBOX_2. FT 205 267 SM00389; HOX_1. FT 206 262 PF00046; Homeobox domain. XX SF 96.7 and 85.1% homology to human T01709 and chick T01708 hoxa9 [4]; SF splice variant hoxa9T T04132 lacks the homeo domain [4]; SF targeted disruption exhibits anterior homeotic transformation in the lumbar region (L1 to L5) of the vertebral column [5]; SF interacts physically with Meis-1T03388 T03389 and binds as heterodimer which stabilizes the Meis-1 DNA interaction complex [3]; XX CP (embryo 12.5 days:) trunk region, (adult:) kidney, large intestine [4]. CN (adult:) brain, stomach, small intestine, liver, spleen, testis [4]. XX FF partial functional redundancy between hoxa9 and HOXD9 T01755 [5]; FF specification of the vertebral identity and development of the forelimb stylopod [5]; XX IN T03388 meis1-a; mouse, Mus musculus. IN T03389 meis1-b; mouse, Mus musculus. IN T04254 Smad1; mouse, Mus musculus. IN T05067 Smad4; mouse, Mus musculus. IN T04236 Smad6; mouse, Mus musculus. XX MX M07456 V$HOXA913_Q4. MX M01351 V$HOXA9_01. MX M03874 V$HOXA9_Q5. MX M07457 V$HOXA9_Q5_01. MX M00420 V$MEIS1AHOXA9_01. MX M00421 V$MEIS1BHOXA9_02. XX BS R09657. BS R09658. BS R09659. BS R09660. BS R09661. BS R09662. BS R09663. BS R09664. BS R09665. BS R09666. BS R09667. BS R09668. BS R09669. BS R09670. BS R09671. BS R09672. BS R09673. BS R09674. BS R09675. BS R09676. BS R09677. BS R09678. BS R09679. BS R09680. BS R09681. BS R09682. BS R09683. BS R18935. XX DR TRANSPATH: MO000025886. DR EMBL: AB005457; DR EMBL: AB008914; DR EMBL: M28449; DR UniProtKB: P09631-1; XX RN [1]; RE0003895. RX PUBMED: 2574852. RA Acampora D., D'Esposito M., Faiella A., Pannese M., Migliaccio E., Morelli F., Stornaiuolo A., Nigro V., Simeone A., Boncinelli E. RT The human HOX gene family RL Nucleic Acids Res. 17:10385-10402 (1989). RN [2]; RE0003897. RX PUBMED: 2891029. RA Rubin M. R., King W., Toth L. E., Sawczuk I. S., Levine M. S., D'Eustachio P., Nguyen-Huu C. M. RT Murine Hox-1.7 homeo-box gene: cloning, chromosomal location, and expression (revision) RL Mol. Cell. Biol. 8:5593-5593 (1988). RN [3]; RE0015480. RX PUBMED: 9343407. RA Shen W. F., Montgomery J. C., Rozenfeld S., Moskow J. J., Lawrence H. J., Buchberg A. M., Largman C. RT AbdB-like Hox proteins stabilize DNA binding by the Meis1 homeodomain proteins RL Mol. Cell. Biol. 17:6448-6458 (1997). RN [4]; RE0015498. RX PUBMED: 9524228. RA Fujimoto S., Araki K., Chisaka O., Araki M., Takagi K., Yamamura K. RT Analysis of the murine Hoxa-9 cDNA: an alternatively spliced transcript encodes a truncated protein lacking the homeodomain RL Gene 209:77-85 (1998). RN [5]; RE0015499. RX PUBMED: 8625797. RA Fromental-Ramain C., Warot X., Lakkaraju S., Favier B., Haack H., Birling C., Dierich A., Doll e P., Chambon P. RT Specific and redundant functions of the paralogous Hoxa-9 and Hoxd-9 genes in forelimb and axial skeleton patterning RL Development 122:461-472 (1996). XX //