TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08474 XX ID T08474 XX DT 24.01.2006 (created); ran. DT 15.05.2014 (updated); sup. CO Copyright (C), QIAGEN. XX FA beta-catenin-isoform1 XX SY beta-catenin; CTNNB; CTNNB1. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G001701 CTNNB1; HGNC: CTNNB1. XX SZ 781 AA; 85.5 kDa (cDNA) (calc.). XX SQ MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS SQ QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT SQ NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK SQ KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL SQ VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC SQ LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA SQ GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA SQ AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM SQ AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL SQ VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV SQ QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF SQ RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH SQ SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD SQ L XX SC translated from EMBL #X87838 XX FT 1 131 N terminus [15]. FT 29 45 GSK3-beta phosphorylation domain (GSK) [14]. FT 141 180 SM00185; arm_5. FT 146 182 PF02985; HEAT repeat. FT 151 191 PS50176; ARM_REPEAT. FT 181 223 SM00185; arm_5. FT 187 284 harbours a binding site for pontin52 [16]. FT 193 236 PS50176; ARM_REPEAT. FT 224 264 PF00514; Armadillo/beta-catenin-like repeat. FT 224 264 SM00185; arm_5. FT 235 277 PS50176; ARM_REPEAT. FT 265 306 SM00185; arm_5. FT 277 319 PS50176; ARM_REPEAT. FT 308 349 SM00185; arm_5. FT 319 362 PS50176; ARM_REPEAT. FT 329 624 PF00478; IMP dehydrogenase / GMP reductase domain. FT 350 390 PF00514; Armadillo/beta-catenin-like repeat. FT 350 390 SM00185; arm_5. FT 391 429 PF00514; Armadillo/beta-catenin-like repeat. FT 392 429 SM00185; arm_5. FT 400 442 PS50176; ARM_REPEAT. FT 430 473 SM00185; arm_5. FT 431 473 PF00514; Armadillo/beta-catenin-like repeat. FT 442 484 PS50176; ARM_REPEAT. FT 478 519 SM00185; arm_5. FT 489 532 PS50176; ARM_REPEAT. FT 520 582 SM00185; arm_5. FT 583 623 PF00514; Armadillo/beta-catenin-like repeat. FT 583 623 SM00185; arm_5. FT 594 636 PS50176; ARM_REPEAT. FT 624 664 PF00514; Armadillo/beta-catenin-like repeat. FT 624 664 SM00185; arm_5. FT 696 781 C-terminus [15]. XX IN T06029 Sox-17; mouse, Mus musculus. IN T06030 Sox-17; human, Homo sapiens. IN T01838 Sox-4; mouse, Mus musculus. IN T00794 TBP; human, Homo sapiens. IN T02918 TCF-4; human, Homo sapiens. XX DR TRANSPATH: MO000058538. DR EMBL: BC058926; DR UniProtKB: P35222-1; XX RN [1]; RE0035178. RX PUBMED: 11463391. RA Yu J., Zhang L., Hwang P. M., Kinzler K. W., Vogelstein B. RT PUMA induces the rapid apoptosis of colorectal cancer cells. RL Mol. Cell 7:673-682 (2001). RN [2]; RE0052419. RX PUBMED: 17468517. RA Saegusa M., Hashimura M., Kuwata T., Hamano M., Wani Y., Okayasu I. RT A functional role of Cdx2 in beta-catenin signaling during transdifferentiation in endometrial carcinomas. RL Carcinogenesis 28:1885-1892 (2007). RN [3]; RE0053289. RX PUBMED: 9739078. RA Kowalczyk A. P., Navarro P., Dejana E., Bornslaeger E. A., Green K. J., Kopp D. S., Borgwardt J. E. RT VE-cadherin and desmoplakin are assembled into dermal microvascular endothelial intercellular junctions: a pivotal role for plakoglobin in the recruitment of desmoplakin to intercellular junctions. RL J. Cell Sci. 111:3045-3057 (1998). RN [4]; RE0064296. RX PUBMED: 15853773. RA Ghiselli G., Agrawal A. RT The human D-glucuronyl C5-epimerase gene is transcriptionally activated through the beta-catenin-TCF4 pathway. RL Biochem. J. 390:493-499 (2005). RN [5]; RE0066740. RX PUBMED: 18667832. RA Ress A., Moelling K. RT The PDZ protein erbin modulates beta-catenin-dependent transcription. RL Eur. Surg. Res. 41:284-289 (2008). RN [6]; RE0067112. RX PUBMED: 17875931. RA Sinner D., Kordich J. J., Spence J. R., Opoka R., Rankin S., Lin S. C., Jonatan D., Zorn A. M., Wells J. M. RT Sox17 and Sox4 differentially regulate beta-catenin/T-cell factor activity and proliferation of colon carcinoma cells. RL Mol. Cell. Biol. 27:7802-7815 (2007). RN [7]; RE0068708. RX PUBMED: 20307497. RA Kim E. A., Kim J. E., Sung K. S., Choi D. W., Lee B. J., Choi C. Y. RT Homeodomain-interacting protein kinase 2 (HIPK2) targets beta-catenin for phosphorylation and proteasomal degradation. RL Biochem. Biophys. Res. Commun. 394:966-971 (2010). RN [8]; RE0071192. RX PUBMED: 15371335. RA Brembeck F. H., Schwarz-Romond T., Bakkers J., Wilhelm S., Hammerschmidt M., Birchmeier W. RT Essential role of BCL9-2 in the switch between beta-catenin's adhesive and transcriptional functions. RL Genes Dev. 18:2225-2230 (2004). RN [9]; RE0071270. RX PUBMED: 9110993. RA Obama H., Ozawa M. RT Identification of the domain of alpha-catenin involved in its association with beta-catenin and plakoglobin (gamma-catenin). RL J. Biol. Chem. 272:11017-11020 (1997). RN [10]; RE0071364. RX PUBMED: 15254236. RA Hogan C., Serpente N., Cogram P., Hosking C. R., Bialucha C. U., Feller S. M., Braga V. M., Birchmeier W., Fujita Y. RT Rap1 regulates the formation of E-cadherin-based cell-cell contacts. RL Mol. Cell. Biol. 24:6690-6700 (2004). RN [11]; RE0071593. RX PUBMED: 11716761. RA Woodfield R. J., Hodgkin M. N., Akhtar N., Morse M. A., Fuller K. J., Saqib K., Thompson N. T., Wakelam M. J. RT The p85 subunit of phosphoinositide 3-kinase is associated with beta-catenin in the cadherin-based adhesion complex. RL Biochem. J. 360:335-344 (2001). RN [12]; RE0071618. RX PUBMED: 19001871. RA Arai T., Haze K., Iimura-Morita Y., Machida T., Iida M., Tanaka K., Komatani H. RT Identification of beta-catenin as a novel substrate of Polo-like kinase 1. RL Cell Cycle 7:3556-3563 (2008). RN [13]; RE0072503. RX PUBMED: 20840866. RA Simoneau M., Coulombe G., Vandal G., Vezina A., Rivard N. RT SHP-1 inhibits beta-catenin function by inducing its degradation and interfering with its association with TATA-binding protein. RL Cell. Signal. 23:269-279 (2011). RN [14]; RE0014117. RX PUBMED: 10580987. RA Morin P. J. RT Beta-catenin signaling and cancer RL BioEssays 21:1021-1030 (1999). RN [15]; RE0014125. RX PUBMED: 7806582. RA Hulsken J., Birchmeier W., Behrens J. RT E-cadherin and APC compete for the interaction with beta-catenin and the cytoskeleton RL J. Cell Biol. 127:2061-2069 (1994). RN [16]; RE0014262. RX PUBMED: 9843967. RA Bauer A., Huber O., Kemler R. RT Pontin52, an interaction partner of beta-catenin, binds to the TATA box binding protein RL Proc. Natl. Acad. Sci. USA 95:14787-14792 (1998). XX //