TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09187 XX ID T09187 XX DT 07.08.2006 (created); man. DT 29.12.2014 (updated); ros. CO Copyright (C), QIAGEN. XX FA Id2 XX SY Id-2; inhibitor of DNA-binding 2. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G003949 ID2; HGNC: ID2. XX CL C0011; HLH. XX SZ 134 AA; 14.9 kDa (cDNA) (calc.). XX SQ MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVS SQ KMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEF SQ PSELMSNDSKALCG XX SC Swiss-Prot#Q02363 XX FT 8 76 PS50888; HLH. FT 24 76 PF00010; Helix-loop-helix DNA-binding domain. FT 28 81 SM00353; finulus. XX IN T05869 BMAL1; mouse, Mus musculus. IN T05868 Clock; mouse, Mus musculus. IN T10260 CLOCK; human, Homo sapiens. IN T00525 MyoD; human, Homo sapiens. IN T16059 pax-2; mouse, Mus musculus. IN T09204 Pax-5-isoform1; human, Homo sapiens. IN T09184 Pax-8; mouse, Mus musculus. IN T16654 SAP-1; Mammalia. IN T15307 SNA; mouse, Mus musculus. XX DR TRANSPATH: MO000084433. DR EMBL: D13891; DR EMBL: L31815; DR EMBL: M97796; DR UniProtKB: Q02363; XX RN [1]; RE0002425. RX PUBMED: 1741406. RA Biggs J., Murphy E. V., Israel M. A. RT A human Id-like helix-loop-helix protein expressed during early development RL Proc. Natl. Acad. Sci. USA 89:1512-1516 (1992). RN [2]; RE0004172. RX PUBMED: 7983058. RA Kurabayashi M., Dutta S., Kedes L. RT Serum-inducible factors binding to an activating transcription factor motif regulate transcription of the Id2A promoter during myogenic differentiation RL J. Biol. Chem. 269:31162-31170 (1994). RN [3]; RE0004173. RX PUBMED: 7926730. RA Iavarone A., Garg P., Lasorella A., Hsu J., Israel M. A. RT The helix-loop-helix protein Id-2 enhances cell proliferation and binds to the retinoblastoma protein RL Genes Dev. 8:1270-1284 (1994). RN [4]; RE0004174. RX PUBMED: 8224921. RA Kurabayashi M., Jeyaseelan R., Kedes L. RT Two distinct cDNA sequences encoding the human helix-loop-helix protein Id2 RL Gene 133:305-306 (1993). RN [5]; RE0005842. RX PUBMED: 8294468. RA Hara E., Yamaguchi T., Nojima H., Ide T., Campisi J., Okayama H., Oda K. RT Id-related genes encoding helix-loop-helix proteins are required for G1 progression and are repressed in senescent human fibroblasts RL J. Biol. Chem. 269:2139-2145 (1994). RN [6]; RE0039511. RX PUBMED: 9235903. RA Anand G., Yin X., Shahidi A. K., Grove L., Prochownik E. V. RT Novel regulation of the helix-loop-helix protein Id1 by S5a, a subunit of the 26 S proteasome RL J. Biol. Chem. 272:19140-51 (1997). RN [7]; RE0049099. RX PUBMED: 10502414. RA Law S. F., Zhang Y. Z., Fashena S. J., Toby G., Estojak J., Golemis E. A. RT Dimerization of the docking/adaptor protein HEF1 via a carboxy-terminal helix-loop-helix domain. RL Exp. Cell Res. 252:224-235 (1999). XX //