TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00652 XX ID T00652 XX DT 27.01.1993 (created); hse. DT 21.01.2015 (updated); ros. CO Copyright (C), QIAGEN. XX FA Oct3-isoform1 XX SY DADB-104B20.2; MGC22487; Oct-3; Oct-3A; Oct-4; OCT3; Oct4; Otf-3; OTF3; OTF4; POU class 5 homeobox 1; POU domain, class 5, transcription factor 1; POU5F1; POU5F1A; POU5F1B. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G002472 POU5F1; HGNC: POU5F1. XX CL C0007; POU; 3.1.10.5.1.1. XX SZ 360 AA; 38.6 kDa (cDNA) (calc.), 42, 35 kDa (SDS) XX SQ MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGI SQ PPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPG SQ AVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFS SQ QTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENR SQ VRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEA SQ AGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN XX SC Swiss-Prot#Q01860-1 XX FT 138 212 PF00157; Pou domain - N-terminal to homeobox domain. FT 138 212 SM00352; pou. FT 228 288 PS50071; HOMEOBOX_2. FT 228 290 PS50550; POU_HOMEODOMAIN. FT 230 292 SM00389; HOX_1. FT 231 287 PF00046; Homeobox domain. XX SF exists in a major (42 kDa) and a minor (35 kDa) form; SF a splice variant is POU5F1B (Oct-3B) T01872, whereas POU5F1C (Oct-3C) T04471 is the product of a distinct gene [3]; XX CP embryonic cells, adult heart, kidney, liver, ovary and testis [3]; embryonic stem cells [4] [4] [3]; germ cells, embryonic stem cells, whole embryo at various stages of development [5]. XX FF activator [1]; FF although Oct4 could not bind the FoxA1 R16330 or FoxA2 R16331 promoters, it could repress FoxD3 T04167 activation of those promoters [4]; FF Oct4 alone does not inhibit FoxA1 T02512 or FoxA2 T02513acitvation of its own promoters, as it did with FoxD3 T04167 [4]; FF Oct4 inhibits almost completely the activation of the FoxA1 and FoxA2 promoter by FoxD3 T04167 [4]; FF interaction between FoxD3 and Oct4, which implies that when Oct4 is not binding to DNA it can function as a corepressor to inhibit the lineage-specific promoter used [4]; XX IN T14243 GKLF; human, Homo sapiens. IN T04167 HFH2; human, Homo sapiens. IN T00652 Oct3-isoform1; human, Homo sapiens. IN T04915 Sox-2; human, Homo sapiens. IN T09970 Sox-2; human, Homo sapiens. XX MX M03837 V$OCT3_Q6. MX M01125 V$OCT4_01. MX M01124 V$OCT4_02. MX M00795 V$OCT_Q6. XX BS R16329. BS R02227. BS R16330. BS R16331. XX DR TRANSPATH: MO000046031. DR EMBL: Z11898; HSOTF3AMR. DR EMBL: Z11900; HSOTF3G. DR UniProtKB: Q01860-1; XX RN [1]; RE0000424. RX PUBMED: 2573524. RA Schoeler H. R., Balling R., Hatzopoulos A. K., Suzuki N., Gruss P. RT Octamer binding proteins confer transcriptional activity in early mouse embryogenesis RL EMBO J. 8:2551-2557 (1989). RN [2]; RE0004221. RX PUBMED: 2739723. RA He X., Treacy M. N., Simmons D. M., Ingraham H. A., Swanson L. W., Rosenfeld M. G. RT Expression of a large family of POU-domain regulatory genes in mammalian brain development RL Nature 340:35-42 (1989). RN [3]; RE0004391. RX PUBMED: 1408763. RA Takeda J., Seino S., Bell G. I. RT Human Oct3 gene family: cDNA sequences, alternative splicing, gene organization, chromosomal location, and expression at low levels in adult tissues RL Nucleic Acids Res. 20:4613-4620 (1992). RN [4]; RE0025441. RX PUBMED: 11891324. RA Guo Y., Costa R., Ramsey H., Starnes T., Vance G., Robertson K., Kelley M., Reinbold R., Scholer H., Hromas R. RT The embryonic stem cell transcription factors Oct-4 and FoxD3 interact to regulate endodermal-specific promoter expression. RL Proc. Natl. Acad. Sci. USA 99:3663-3667 (2002). RN [5]; RE0047687. RX PUBMED: 11044462. RA Hansis C., Grifo J. A., Krey L. C. RT Oct-4 expression in inner cell mass and trophectoderm of human blastocysts. RL Mol. Hum. Reprod. 6:999-1004 (2000). XX //