AC T01440
XX
ID T01440
XX
DT 10.04.1995 (created); ewi.
DT 05.03.2014 (updated); mkl.
CO Copyright (C), QIAGEN.
XX
FA NF-E2p45
XX
SY NF-E2 p45; nuclear factor erythroid 2 p45.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G003934 NFE2; HGNC: NFE2.
XX
HO Cnc (D. melanogaster).
XX
CL C0008; bZIP.
XX
SZ 373 AA; 41.5 kDa (cDNA) (calc.), 45 kDa (SDS)
XX
SQ MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPP
SQ PPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPL
SQ QDPLALLDIGLPAGPPKPQEDPESDSGLSLNYSDAESLELEGTEAGRRRSEYVEMYPVEY
SQ PYSLMPNSLAHSNYTLPAAETPLALEPSSGPVRAKPTARGEAGSRDERRALAMKIPFPTD
SQ KIVNLPVDDFNELLARYPLTESQLALVRDIRRRGKNKVAAQNCRKRKLETIVQLERELER
SQ LTNERERLLRARGEADRTLEVMRQQLTELYRDIFQHLRDESGNSYSPEEYALQQAADGTI
SQ FLVPRGTKMEATD
XX
SC translated from EMBL #L24122
XX
FT 264 328 
PF00170; bZIP transcription factor.
FT 264 328 
SM00338; brlzneu.
FT 266 329 
PS50217; BZIP.
XX
SF bZIP domain is similar to that of AP-1 components;
SF outside bZIP: similar to Cnc (D. melanogaster);
SF no homodimeric DNA-binding, obligate heterodimer with a ubiquitous Maf component (NF-E2 p18) [6];
SF there are two splice variants that differ in their 5'-untranslated region [7];
SF the shorter form fNF-E2 originates from a promoter within intron I;
SF it is more abundant in fetal liver and less in bone marrow than aNF-E2 [7];
SF both mRNAs produce the same two proteins (a second one arises from usage of an alternative translation initiation codon), but aNF-E2 facilitates usage of the second codon [7];
XX
CP erythroid cell lines, peripheral blood leukocytes, spleen, lung, placenta, liver; (low:) testis, colon [5] [6].
CN brain, heart, kidney, ovary, pancreas, prostate, skeletal muscle, small intestine, thymus [5] [6].
XX
FF erythroid-specific component of NF-E2 [5] [6];
FF overcomes transcriptional repression exerted by MafK or MafF [4];
XX
IN T01436 MafF; chick, Gallus gallus.
IN T01437 MafG; chick, Gallus gallus.
IN T04870 MafG; human, Homo sapiens.
IN T09572 MafG; human, Homo sapiens.
IN T01434 MafK; chick, Gallus gallus.
IN T01435 MafK; mouse, Mus musculus.
IN T09555 MafK; human, Homo sapiens.
IN T01440 NF-E2p45; human, Homo sapiens.
IN T01443 Nrf2; human, Homo sapiens.
IN T19118 Nrf3-xbb1; human, Homo sapiens.
IN T27866 Zhangfei; human, Homo sapiens.
XX
MX M07296 V$MAF_Q4.
MX M00983 V$MAF_Q6_01.
MX M00037 V$NFE2_01.
MX M02104 V$NFE2_Q6.
XX
BS R04549.
XX
DR TRANSPATH: MO000025665.
DR EMBL: L13974;
DR EMBL: L24122;
DR UniProtKB: Q16621;
XX
RN [1]; RE0002020.
RX PUBMED: 2911469.
RA Mignotte V., Wall L., deBoer E., Grosveld F., Romeo P.-H.
RT Two tissue-specific factors bind to the erythroid promoter of the human porphobilinogen deaminase gene
RL Nucleic Acids Res. 17:37-54 (1989).
RN [2]; RE0002119.
RX PUBMED: 2235483.
RA Ney P. A., Sorrentino B. P., Lowrey Ch. H., Nienhuis A. W.
RT Inducibility of the HS II enhancer depends on binding of an erythroid specific nuclear protein
RL Nucleic Acids Res. 18:6011-6017 (1990).
RN [3]; RE0002382.
RX PUBMED: 2771941.
RA Mignotte V., Eleouet J. F., Raich N., Romeo P.-H.
RT Cis- and trans-acting elements involved in the regulation of the erythroid promoter of the human porphobilinogen deaminase gene
RL Proc. Natl. Acad. Sci. USA 86:6548-6552 (1989).
RN [4]; RE0003522.
RX PUBMED: 8107826.
RA Igarashi K., Kataoka K., Itoh K., Hayashi N., Nishizawa M., Yamamoto M.
RT Regulation of transcription by dimerization of erythroid factor NF-E2 p45 with small Maf proteins
RL Nature 367:568-572 (1994).
RN [5]; RE0003524.
RX PUBMED: 8248255.
RA Chan J. Y., Han X.-L., Kan Y. W.
RT Isolation of cDNA encoding the human NF-E2 protein
RL Proc. Natl. Acad. Sci. USA 90:11366-11370 (1993).
RN [6]; RE0003526.
RX PUBMED: 8355703.
RA Ney P. A., Andrews N. C., Jane S. M., Safer B., Purucker M. E., Weremowicz S., Morton C. C., Goff S. C., Orkin S. H., Nienhuis A. W.
RT Purification of the human NF-E2 complex: cDNA cloning of the hematopoietic cell-specific subunit and evidence for an associated partner
RL Mol. Cell. Biol. 13:5604-5612 (1993).
RN [7]; RE0003528.
RX PUBMED: 7724591.
RA Pischedda C., Cocco S., Melis A., Marini M. G., Kan Y. W., Cao A., Moi P.
RT Isolation of a differentially regulated splicing isoform of human NF-E2
RL Proc. Natl. Acad. Sci. USA 92:3511-3515 (1995).
RN [8]; RE0004917.
RX PUBMED: 8504248.
RA Crossley M., Orkin S.
RT Regulation of the beta-globin locus
RL Curr. Opin. Gen. Dev. 3:232-237 (1993).
RN [9]; RE0004918.
RX PUBMED: 8516848.
RA Dillon N., Grosveld F.
RT Transcriptional regulation of multigene loci: multilevel control
RL Trends Genet. 9:134-137 (1993).
RN [10]; RE0048287.
RX PUBMED: 12805554.
RA Newman J. R., Keating A. E.
RT Comprehensive identification of human bZIP interactions with coiled-coil arrays.
RL Science 300:2097-2101 (2003).
RN [11]; RE0049261.
RX PUBMED: 16287851.
RA Shyu Y. C., Lee T. L., Ting C. Y., Wen S. C., Hsieh L. J., Li Y. C., Hwang J. L., Lin C. C., Shen C. K.
RT Sumoylation of p45/NF-E2: nuclear positioning and transcriptional activation of the mammalian beta-like globin gene locus.
RL Mol. Cell. Biol. 25:10365-10378 (2005).
XX
//