TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02056 XX ID T02056 XX DT 28.01.1997 (created); hiwi. DT 06.09.2013 (updated); spk. CO Copyright (C), QIAGEN. XX FA ATF-2-isoform1 XX SY ATF-2 (human); CRE-BP1; CREBP1; HB16; TREB-7; XBP-4; XBP4. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G009504 Atf2. XX CL C0008; bZIP. XX SZ 487 AA; 52.3 kDa (cDNA) (calc.). XX SQ MSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKN SQ CEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPL SQ PHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVI SQ TQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNVHVPAAVPLVRPVTMVPSV SQ PGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGSGLVRTQSEESRPQSLQQP SQ ATSTTETPASPAHTTPQTQNTSGRRRRAANEDPDEKRRKFLERNRAAASRCRQKRKVWVQ SQ SLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTADKDDSS SQ EDLSVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQMADQSTEPALSQIVMAPPS SQ QAQPSGS XX SC Swiss-Prot#P16951-1 XX FT 117 456 PF00478; IMP dehydrogenase / GMP reductase domain. FT 300 364 PF00170; bZIP transcription factor. FT 300 364 SM00338; brlzneu. FT 302 365 PS50217; BZIP. XX SF alternative splice products: CRE-BP2 T01017, CRE-BP3 T02036; SF Thr-69 and Thr-71 are essential for E1A-induced and ATF-2-isoform1-mediated transcriptional activation [1]; SF lacking the N-terminal zinc finger motif [2]; XX CP ubiquitous [2]. XX FF may be transcriptionally inert, presumably due to the lack of the N-terminal zinc finger motif found in human ATF-2-isoform1 T00167 [2]; FF required for normal skeletal and CNS development, lack of ATF-2-isoform1 leads to defects in enchondral ossification and causes ataxy, hyperactivity, and decreased hearing [4]; FF phosphorylation by a JNK/SAPK kinase of the MAPK family at Thr-69 and -71 mediates activation in response to UV or other cellular stresses [1] [3]; XX IN T01017 ATF-2-isoform2; mouse, Mus musculus. IN T00122 c-Fos; mouse, Mus musculus. IN T10332 ipf1; Mammalia. IN T09908 MafA; mouse, Mus musculus. IN T14436 NeuroD-1; Mammalia. XX MX M07312 V$ATF2_Q6. MX M00981 V$CREBATF_Q6. MX M00041 V$CREBP1CJUN_01. MX M00040 V$CREBP1_01. MX M00179 V$CREBP1_Q2. MX M00801 V$CREB_Q3. XX DR TRANSPATH: MO000026127. DR EMBL: S76657; DR UniProtKB: P16951-1; XX RN [1]; RE0005261. RX PUBMED: 7737129. RA Livingstone C., Patel G., Jones N. RT ATF-2 contains a phosphorylation-dependent transcriptional activation domain RL EMBO J. 14:1785-1797 (1995). RN [2]; RE0005262. RX PUBMED: 1531087. RA Georgopoulos K., Morgan B. A., Moore D. D. RT Functionally distinct isoforms of the CRE-BP DNA-binding protein mediate activity of a T-cell-specific enhancer RL Mol. Cell. Biol. 12:747-757 (1992). RN [3]; RE0005263. RX PUBMED: 7737130. RA van Dam H., Wilhelm D., Herr I., Steffen A., Herrlich P., Angel P. RT ATF-2 is preferentially activated by stress-activated protein kinases to mediate c-jun induction in response to genotoxic agents RL EMBO J. 14:1798-1811 (1995). RN [4]; RE0005264. RX PUBMED: 8538792. RA Reimold A. M., Grusby M. J., Kosaras B., Fries J. W. U., Mori R., Maniwa S., Clauss I. M., Collins T., Sidman R. L., Glimcher M. J., Glimcher L. H. RT Chondrysplasia and neurological abnormalities in ATF-2 deficient mice RL Nature 379:262-265 (1996). XX //