TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T04498 XX ID T04498 XX DT 18.05.2001 (created); mas. DT 10.07.2014 (updated); pos. CO Copyright (C), QIAGEN. XX FA FXR-isoform4 XX SY BAR; bile acid receptor; farnesoid X activated receptor; farnesoid-X-receptor splice variant alpha; HRR-1; HRR1; NR1H4; retinoid X receptor interacting protein 14; RIP-14; RIP14. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G002745 NR1H4; HGNC: NR1H4. XX CL C0002; CC (rec); 2.1.2.7.3.4. XX SZ 472 AA; 54.4 kDa (cDNA) (calc.). XX SQ MGSKMNLIEHSHLPTTDEFSFSENLFGVLTEQVAGPLGQNLEVEPYSQYSNVQFPQVQPQ SQ ISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAETLYQGETEVAEMPVTKKPRMGASAGR SQ IKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCVMDMYMRRKCQ SQ ECRLRKCKEMGMLAECLLTEIQCKSKRLRKNVKQHADQTVNEDSEGRDLRQVTSTTKSCR SQ EKTELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLILTEMATNHVQVLVE SQ FTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDE SQ YITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCK SQ IHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ XX SC translated from EMBL #U68233 XX FT 4 346 PF00478; IMP dehydrogenase / GMP reductase domai. FT 105 472 LBD, interactions with SRC-1 [6]. FT 124 195 SM00399; c4gold. FT 124 199 PS51030; NUCLEAR_REC_DBD_2. FT 125 200 PF00105; Zinc finger, C4 type (two domains). FT 289 444 SM00430; holi. FT 292 468 PF00104; Ligand-binding domain of nuclear hormon. FT 462 472 AF-2, ligand binding [5]. XX SF one of the splice variants of FXR T05389 [4]; SF forms heterodimer with RXR-alpha [2]; SF intact AF-2 domain is necessary for bile acid-dependent gene activation by FXR/RXR-alpha heterodimers [5]; SF interaction with bile acids enhances direct interactions with co-activator SRC-1 [6]; SF in the presence of bile acids, FXR LBD interacts directly with SRC-1 LXXLL motives [6]; XX CP adrenal, liver, fetal liver [4]. XX FF activator as a heterodimer with RXR-alpha and as such, provides bile acid-dependent gene activation, for details see T05313; FF natural activating ligands: bile acids [6]; XX IN T22248 ChREBP; Mammalia. IN T03828 HNF-4alpha; human, Homo sapiens. IN T01345 RXR-alpha; human, Homo sapiens. IN T04632 SRC-1; human, Homo sapiens. IN T08497 TIF2; human, Homo sapiens. XX MX M07256 V$FXRRXR_Q5. MX M01268 V$FXR_Q2. MX M00631 V$FXR_Q3. MX M03790 V$FXR_Q5. MX M03795 V$LXR_Q6. MX M00964 V$PXR_Q2. XX DR TRANSPATH: MO000028343. DR EMBL: U68233; DR UniProtKB: Q96RI1-2; XX RN [1]; RE0016194. RX PUBMED: 10334993. RA Parks D. J., Blanchard S. G., Bledsoe R. K., Chandra G., Consler T. G., Kliewer S. A., Stimmel J. B., Willson T. M., Zavacki A. M., Moore D. D., Lehmann J. M. RT Bile acids: natural ligands for an orphan nuclear receptor RL Science 284:1365-1368 (1999). RN [2]; RE0016195. RX PUBMED: 10514450. RA Grober J., Zaghini I., Fujii H., Jones S. A., Kliewer S. A., Willson T. M., Ono T., Besnard P. RT Identification of a bile acid-responsive element in the human ileal bile acid-binding protein gene. Involvement of the farnesoid X receptor/9-cis-retinoic acid receptor heterodimer RL J. Biol. Chem. 274:29749-29754 (1999). RN [3]; RE0016409. RX PUBMED: 11030332. RA Goodwin B., Jones S. A., Price R. R., Watson M. A., McKee D. D., Moore L. B., Galardi C., Wilson J. G., Lewis M. C., Roth M. E., Maloney P. R., Willson T. M., Kliewer S. A. RT A regulatory cascade of the nuclear receptors FXR, SHP-1, and LRH-1 represses bile acid biosynthesis RL Mol. Cell 6:517-526 (2000). RN [4]; RE0018089. RX PUBMED: 12062799. RA Huber R. M., Murphy K., Miao B., Link J. R., Cunningham M. R., Rupar M. J., Gunyuzlu P. L., Haws T. F., Kassam A., Powell F., Hollis G. F., Young P. R., Mukherjee R., Burn T. C. RT Generation of multiple farnesoid-X-receptor isoforms through the use of alternative promoters. RL Gene 290:35-43 (2002). RN [5]; RE0018116. RX PUBMED: 11387316. RA Ananthanarayanan M., Balasubramanian N., Makishima M., Mangelsdorf D. J., Suchy F. J. RT Human bile salt export pump promoter is transactivated by the farnesoid X receptor/bile acid receptor. RL J. Biol. Chem. 276:28857-28865 (2001). RN [6]; RE0023349. RX PUBMED: 10334992. RA Makishima M., Okamoto A. Y., Repa J. J., Tu H., Learned R. M., Luk A., Hull M. V., Lustig K. D., Mangelsdorf D. J., Shan B. RT Identification of a nuclear receptor for bile acids. RL Science 284:1362-1365 (1999). RN [7]; RE0023352. RX PUBMED: 12529392. RA Otte K., Kranz H., Kober I., Thompson P., Hoefer M., Haubold B., Remmel B., Voss H., Kaiser C., Albers M., Cheruvallath Z., Jackson D., Casari G., Koegl M., Paabo S., Mous J., Kremoser C., Deuschle U. RT Identification of farnesoid X receptor beta as a novel mammalian nuclear receptor sensing lanosterol. RL Mol. Cell. Biol. 23:864-872 (2003). RN [8]; RE0051204. RX PUBMED: 15471871. RA Ananthanarayanan M., Li S., Balasubramaniyan N., Suchy F. J., Walsh M. J. RT Ligand-dependent activation of the farnesoid X-receptor directs arginine methylation of histone H3 by CARM1. RL J. Biol. Chem. 279:54348-54357 (2004). XX //