AC T09086
XX
ID T09086
XX
DT 15.06.2006 (created); jag.
DT 23.12.2014 (updated); spk.
CO Copyright (C), QIAGEN.
XX
FA Smad2
XX
SY HMAD-2; MADH2; Smad-2.
XX
OS mouse, Mus musculus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G002384 Smad2.
XX
CL C0041; SMAD; 7.1.1.1.2.1.
XX
SZ 467 AA; 52.3 kDa (cDNA) (calc.).
XX
SQ MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCQKAVKSLVKKLKKTGRLDE
SQ LEKAITTQNCNTKCVTIPSTCSEIWGLSTANTVDQWDTTGLYSFSEQTRSLDGRLQVSHR
SQ KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
SQ PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
SQ MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
SQ GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
SQ NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
SQ GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
XX
SC translated from EMBL #U60350
XX
FT 1 109 
MH1 domain [1].
FT 10 176 
PS51075; MH1.
FT 36 174 
SM00523; dwAneu5.
FT 38 171 
PF03165; MH1 domain.
FT 110 273 
Linker region [1].
FT 268 445 
PF03166; MH2 domain.
FT 272 443 
SM00524; DWB.
FT 274 463 
MH2 domain [1].
FT 274 467 
PS51076; MH2.
FT 464 467 
SSXS motif [1].
XX
IN T09289 HOXA13; mouse, Mus musculus.
IN T09291 HOXD13; mouse, Mus musculus.
IN T11119 SIP1; mouse, Mus musculus.
IN T09538 Smad3; Mammalia.
IN T09461 Smad4; mouse, Mus musculus.
XX
MX M08897 V$SMAD_Q4.
MX M00792 V$SMAD_Q6.
MX M00974 V$SMAD_Q6_01.
XX
DR TRANSPATH: MO000083052.
DR EMBL: U60530; MMU60530.
DR UniProtKB: Q62432; SMA2_MOUSE.
XX
RN [1]; RE0015115.
RX PUBMED: 10767528.
RA Dick A., Mayr T., Bauer H., Meier A., Hammerschmidt M.
RT Cloning and characterization of zebrafish smad2, smad3 and smad4
RL Gene 246:69-80 (2000).
RN [2]; RE0015684.
RX PUBMED: 9689088.
RA Weinstein M., Yang X., Li C., Xu X., Gotay J., Deng C. X.
RT Failure of egg cylinder elongation and mesoderm induction in mouse embryos lacking the tumor suppressor smad2
RL Proc. Natl. Acad. Sci. USA 95:9378-9383 (1998).
RN [3]; RE0016216.
RX PUBMED: 10615055.
RA Wu G., Chen Y. G., Ozdamar B., Gyuricza C. A., Chong P. A., Wrana J. L., Massague J., Shi Y.
RT Structural basis of Smad2 recognition by the Smad anchor for receptor activation.
RL Science 287:92-97 (2000).
RN [4]; RE0016380.
RX PUBMED: 11074002.
RA Pierreux C. E., Nicolas F. J., Hill C. S.
RT Transforming growth factor beta-independent shuttling of Smad4 between the cytoplasm and nucleus.
RL Mol. Cell. Biol. 20:9041-9054 (2000).
RN [5]; RE0020663.
RX PUBMED: 10224135.
RA Ishisaki A., Yamato K., Hashimoto S., Nakao A., Tamaki K., Nonaka K., ten Dijke P., Sugino H., Nishihara T.
RT Differential inhibition of Smad6 and Smad7 on bone morphogenetic protein- and activin-mediated growth arrest and apoptosis in B cells
RL J. Biol. Chem. 274:13637-13642 (1999).
RN [6]; RE0022866.
RX PUBMED: 11927558.
RA Goumans M. J., Valdimarsdottir G., Itoh S., Rosendahl A., Sideras P., ten Dijke P.
RT Balancing the activation state of the endothelium via two distinct TGF-beta type I receptors.
RL EMBO J. 21:1743-1753 (2002).
RN [7]; RE0023194.
RX PUBMED: 12145309.
RA Norwitz E. R., Xu S., Xu J., Spiryda L. B., Park J. S., Jeong K. H., McGee E. A., Kaiser U. B.
RT Direct binding of AP-1 (Fos/Jun) proteins to a SMAD binding element facilitates both gonadotropin-releasing hormone (GnRH)- and activin-mediated transcriptional activation of the mouse GnRH receptor gene.
RL J. Biol. Chem. 277:37469-37478 (2002).
RN [8]; RE0031346.
RX PUBMED: 12650946.
RA Warner D. R., Pisano M. M., Roberts E. A., Greene R. M.
RT Identification of three novel Smad binding proteins involved in cell polarity.
RL FEBS Lett. 539:167-73 (2003).
RN [9]; RE0042994.
RX PUBMED: 14651998.
RA Warner D. R., Roberts E. A., Greene R. M., Pisano M. M.
RT Identification of novel Smad binding proteins
RL Biochem. Biophys. Res. Commun. 312:1185-90 (2003).
RN [10]; RE0048068.
RX PUBMED: 15464984.
RA Warner D. R., Bhattacherjee V., Yin X., Singh S., Mukhopadhyay P., Pisano M. M., Greene R. M.
RT Functional interaction between Smad, CREB binding protein, and p68 RNA helicase.
RL Biochem. Biophys. Res. Commun. 324:70-76 (2004).
RN [11]; RE0048069.
RX PUBMED: 14559231.
RA Ellis L. R., Warner D. R., Greene R. M., Pisano M. M.
RT Interaction of Smads with collagen types I, III, and V.
RL Biochem. Biophys. Res. Commun. 310:1117-1123 (2003).
RN [12]; RE0048182.
RX PUBMED: 16087734.
RA Williams T. M., Williams M. E., Heaton J. H., Gelehrter T. D., Innis J. W.
RT Group 13 HOX proteins interact with the MH2 domain of R-Smads and modulate Smad transcriptional activation functions independent of HOX DNA-binding capability.
RL Nucleic Acids Res. 33:4475-4484 (2005).
RN [13]; RE0072535.
RX PUBMED: 18568018.
RA Varelas X., Sakuma R., Samavarchi-Tehrani P., Peerani R., Rao B. M., Dembowy J., Yaffe M. B., Zandstra P. W., Wrana J. L.
RT TAZ controls Smad nucleocytoplasmic shuttling and regulates human embryonic stem-cell self-renewal.
RL Nat. Cell Biol. 10:837-848 (2008).
XX
//