AC T09104
XX
ID T09104
XX
DT 22.06.2006 (created); jag.
DT 06.01.2016 (updated); ros.
CO Copyright (C), QIAGEN.
XX
FA FOXO1A
XX
SY FKHR.
XX
OS mouse, Mus musculus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G002641 Foxo1.
XX
CL C0023; fork head.
XX
SZ 652 AA; 69.6 kDa (cDNA) (calc.).
XX
SQ MAEAPQVVETDPDFEPLPRQRSCTWPLPRPEFNQSNSTTSSPAPSGGAAANPDAAASLAS
SQ ASAVSTDFMSNLSLLEESEDFARAPGCVAVAAAAAASRGLCGDFQGPEAGCVHPAPPQPP
SQ PTGPLSQPPPVPPSAAAAAGPLAGQPRKTSSSRRNAWGNLSYADLITKAIESSAEKRLTL
SQ SQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEG
SQ GKSGKSPRRRAASMDNNSKFAKSRGRAAKKKASLQSGQEGPGDSPGSQFSKWPASPGSHS
SQ NDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGDGDVHSLVYPPSAAKMASTLPSLS
SQ EISNPENMENLLDNLNLLSSPTSLTVSTQSSPGSMMQQTPCYSFAPPNTSLNSPSPNYSK
SQ YTYGQSSMSPLPQMPMQTLQDSKSSYGGLNQYNCAPGLLKELLTSDSPPHNDIMSPVDPG
SQ VAQPNSRVLGQNVMMGPNSVMPAYGSQASHNKMMNPSSHTHPGHAQQTASVNGRTPPHVV
SQ NTMPHTSAMNRLTPVKTPLQVPLSHPMQMSALGRYSSVSSCNGYGRMGVLHQEKLPSDLD
SQ GMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
XX
SC translated from EMBL #AF114258
XX
FT 9 390 
PF00478; IMP dehydrogenase / GMP reductase domain.
FT 118 266 
PF00250; Fork head domain.
FT 155 245 
SM00339; forkneu4.
FT 157 251 
PS50039; FORK_HEAD_3.
FT 242 242 
acetylation site [6].
FT 245 245 
acetylation site [6].
FT 253 253 
phosphorylation site [6].
FT 262 262 
acetylation site [6].
XX
FF plays an important role in mediating the effect of insulin on hepatic metabolism [8];
FF interferes with myoblast differentiation and myotube formation [10];
FF activation of Foxo1 in the hypothalamus increases food intake and body weight, whereas inhibition of Foxo1 decreases both [11];
FF govern cell growth in the heart [9];
XX
IN T08465 C/EBPalpha-isoform1; human, Homo sapiens.
IN T05687 CAR; mouse, Mus musculus.
IN T15118 CBP; Mammalia.
IN T08235 PXR; mouse, Mus musculus.
IN T32366 SIRT1-isoform1; mouse, Mus musculus.
IN T09538 Smad3; Mammalia.
IN T13998 Smad4; Mammalia.
XX
MX M07286 V$FOXO1A_Q3.
MX M00473 V$FOXO1_01.
MX M00474 V$FOXO1_02.
MX M01216 V$FOXO1_Q5.
XX
BS R10898.
BS R10899.
BS R10900.
BS R10901.
BS R10902.
BS R10903.
BS R10904.
BS R10905.
BS R10906.
BS R10907.
BS R10908.
BS R10909.
BS R10910.
BS R10911.
BS R10912.
BS R10913.
BS R10914.
BS R10915.
BS R10916.
BS R10917.
BS R10918.
BS R30868.
BS R30869.
BS R30874.
BS R18148.
BS R17148.
BS R71206.
BS R38647.
XX
DR TRANSPATH: MO000083443.
DR TRANSCOMPEL: C00518.
DR EMBL: AF114258; AF114258.
DR UniProtKB: Q9R1E0;
XX
RN [1]; RE0015570.
RA Biggs W. H., Cavenee W. K., Arden K. C.
RT Identification and Characterization of Murine Members of the FKHR Subclass of Winged-Helix Transcription Factors
RL direct submission (EMBL) : ().
RN [2]; RE0016820.
RX PUBMED: 11353388.
RA Biggs W. H. 3rd, Cavenee W. K., Arden K. C.
RT Identification and characterization of members of the FKHR (FOX O) subclass of winged-helix transcription factors in the mouse
RL Mamm. Genome 12:416-425 (2001).
RN [3]; RE0016824.
RX PUBMED: 10880363.
RA Furuyama T., Nakazawa T., Nakano I., Mori N.
RT Identification of the differential distribution patterns of mRNAs and consensus binding sequences for mouse DAF-16 homologues
RL Biochem. J. 349:629-634 (2000).
RN [4]; RE0030982.
RX PUBMED: 15084259.
RA Seoane J., Le H. V., Shen L., Anderson S. A., Massague J.
RT Integration of Smad and forkhead pathways in the control of neuroepithelial and glioblastoma cell proliferation.
RL Cell 117:211-23 (2004).
RN [5]; RE0033289.
RX PUBMED: 15220471.
RA Daitoku H., Hatta M., Matsuzaki H., Aratani S., Ohshima T., Miyagishi M., Nakajima T., Fukamizu A.
RT Silent information regulator 2 potentiates Foxo1-mediated transcription through its deacetylase activity.
RL Proc. Natl. Acad. Sci. USA 101:10042-7 (2004).
RN [6]; RE0035780.
RX PUBMED: 16076959.
RA Matsuzaki H., Daitoku H., Hatta M., Aoyama H., Yoshimochi K., Fukamizu A.
RT Acetylation of Foxo1 alters its DNA-binding ability and sensitivity to phosphorylation.
RL Proc. Natl. Acad. Sci. USA 102:11278-11283 (2005).
RN [7]; RE0048304.
RX PUBMED: 15340055.
RA Kodama S., Koike C., Negishi M., Yamamoto Y.
RT Nuclear receptors CAR and PXR cross talk with FOXO1 to regulate genes that encode drug-metabolizing and gluconeogenic enzymes.
RL Mol. Cell. Biol. 24:7931-7940 (2004).
RN [8]; RE0048485.
RX PUBMED: 16997836.
RA Qu S., Altomonte J., Perdomo G., He J., Fan Y., Kamagate A., Meseck M., Dong H. H.
RT Aberrant FoxO1 Function Is Associated with Impaired Hepatic Metabolism.
RL Endocrinology 147:5641-5652 (2006).
RN [9]; RE0048486.
RX PUBMED: 16952979.
RA Ni Y. G., Berenji K., Wang N., Oh M., Sachan N., Dey A., Cheng J., Lu G., Morris D. J., Castrillon D. H., Gerard R. D., Rothermel B. A., Hill J. A.
RT Foxo transcription factors blunt cardiac hypertrophy by inhibiting calcineurin signaling.
RL Circulation 114:1159-1168 (2006).
RN [10]; RE0048487.
RX PUBMED: 16806782.
RA Arden K. C.
RT Multiple roles of FOXO transcription factors in mammalian cells point to multiple roles in cancer.
RL Exp. Gerontol. 41:709-717 (2006).
RN [11]; RE0048489.
RX PUBMED: 16783365.
RA Kim M. S., Pak Y. K., Jang P. G., Namkoong C., Choi Y. S., Won J. C., Kim K. S., Kim S. W., Kim H. S., Park J. Y., Kim Y. B., Lee K. U.
RT Role of hypothalamic Foxo1 in the regulation of food intake and energy homeostasis.
RL Nat. Neurosci. 9:901-906 (2006).
RN [12]; RE0055497.
RX PUBMED: 17923482.
RA Hatta M., Cirillo L. A.
RT Chromatin opening and stable perturbation of core histone:DNA contacts by FoxO1.
RL J. Biol. Chem. 282:35583-35593 (2007).
RN [13]; RE0055918.
RX PUBMED: 17717603.
RA Kitamura T., Kitamura Y. I., Funahashi Y., Shawber C. J., Castrillon D. H., Kollipara R., DePinho R. A., Kitajewski J., Accili D.
RT A Foxo/Notch pathway controls myogenic differentiation and fiber type specification.
RL J. Clin. Invest. 117:2477-2485 (2007).
RN [14]; RE0055955.
RX PUBMED: 10347145.
RA Nakae J., Park B. C., Accili D.
RT Insulin stimulates phosphorylation of the forkhead transcription factor FKHR on serine 253 through a Wortmannin-sensitive pathway.
RL J. Biol. Chem. 274:15982-15985 (1999).
RN [15]; RE0065023.
RX PUBMED: 15123605.
RA Tsuchida A., Yamauchi T., Ito Y., Hada Y., Maki T., Takekawa S., Kamon J., Kobayashi M., Suzuki R., Hara K., Kubota N., Terauchi Y., Froguel P., Nakae J., Kasuga M., Accili D., Tobe K., Ueki K., Nagai R., Kadowaki T.
RT Insulin/Foxo1 pathway regulates expression levels of adiponectin receptors and adiponectin sensitivity.
RL J. Biol. Chem. 279:30817-30822 (2004).
RN [16]; RE0067774.
RX PUBMED: 17077083.
RA Cao Y., Kamioka Y., Yokoi N., Kobayashi T., Hino O., Onodera M., Mochizuki N., Nakae J.
RT Interaction of FoxO1 and TSC2 induces insulin resistance through activation of the mammalian target of rapamycin/p70 S6K pathway.
RL J. Biol. Chem. 281:40242-40251 (2006).
RN [17]; RE0068651.
RX PUBMED: 19696026.
RA Sengupta A., Molkentin J. D., Yutzey K. E.
RT FoxO transcription factors promote autophagy in cardiomyocytes.
RL J. Biol. Chem. 284:28319-28331 (2009).
XX
//