TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00373 XX ID T00373 XX DT 26.01.1993 (created); hse. DT 31.01.2014 (updated); jmh. CO Copyright (C), QIAGEN. XX FA HNF-4alpha1 XX SY hepatic nuclear factor 4, alpha; hepatocyte nuclear factor 4, alpha; HNF-4B; HNF4; HNF4alpha; MODY; MODY1; NR2A1; NR2A21; TCF; TCF14; transcription factor-14. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G001926 HNF4A; HGNC: HNF4A. XX CL C0002; CC (rec); 2.1.3.2.1.1. XX SZ 474 AA; 52.8 kDa (cDNA) (calc.), 54 kDa (SDS) XX SQ MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALC SQ AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKC SQ FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKK SQ IASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFK SQ DVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAK SQ GLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKL SQ FGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEW SQ PRPRGQAATPETPQPSPPGASGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI XX SC edited Swiss-Prot #P41235 XX FT 1 59 A/B region [4]. FT 11 388 PF00478; IMP dehydrogenase / GMP reductase domai. FT 57 128 SM00399; c4gold. FT 57 132 PS51030; NUCLEAR_REC_DBD_2. FT 58 133 PF00105; Zinc finger, C4 type (two domains). FT 60 125 C region (DNA binding) [4]. FT 126 142 D region [4]. FT 143 377 E region (ligand binding) [4]. FT 189 348 SM00430; holi. FT 192 373 PF00104; Ligand-binding domain of nuclear hormon. FT 378 474 F region [4]. XX SF the originally published 465-AA sequence may lack 9 N-terminal amino acid residues of the authentic protein [4]; XX CP liver, kidney, intestine. XX FF can act via different sites as activator or repressor [4]; XX IN T01346 arnt-isoform1; human, Homo sapiens. IN T09359 GATA-4-isoform1; human, Homo sapiens. IN T01610 HIF-1alpha; human, Homo sapiens. IN T02428 HNF-4alpha3; human, Homo sapiens. IN T15516 HNF-4gamma-isoform1; human, Homo sapiens. IN T01035 islet1-isoform1; rat, Rattus norvegicus. IN T10924 islet1; rat, Rattus norvegicus. XX MX M00158 V$COUP_01. MX M00762 V$DR1_Q3. MX M00638 V$HNF4ALPHA_Q6. MX M02220 V$HNF4A_03. MX M07321 V$HNF4A_Q3. MX M00764 V$HNF4DR1_Q3. MX M00134 V$HNF4_01. MX M00411 V$HNF4_01_B. MX M00967 V$HNF4_Q6. MX M01031 V$HNF4_Q6_01. MX M01032 V$HNF4_Q6_02. MX M01033 V$HNF4_Q6_03. MX M03828 V$HNF4_Q6_04. XX BS R25058. BS R04591. BS R02179. BS R04454. BS R15916. BS R32979. BS R32980. BS R56525. BS R60050. BS R28220. BS R28221. BS R19255. BS R28222. BS R37107. BS R31339. BS R20539. XX DR TRANSPATH: MO000024885. DR EMBL: X76930; DR EMBL: X87871; DR UniProtKB: P41235-1; XX RN [1]; RE0001457. RX PUBMED: 2325638. RA Paulson K. E., Darnell J. E., Rushmore T., Pickett C. B. RT Analysis of the upstream elements of the xenobiotic compound-inducible and positionally regulated glutathione S-transferase Ya gene RL Mol. Cell. Biol. 10:1841-1852 (1990). RN [2]; RE0001476. RX PUBMED: 2786140. RA Costa R. H., Grayson D. R., Darnell J. E. RT Multiple hepatocyte-enriched nuclear factors function in the regulation of transthyretin and alpha1-antitrypsin genes RL Mol. Cell. Biol. 9:1415-1425 (1989). RN [3]; RE0006828. RX PUBMED: 7926813. RA Chartier F. L., Bossu J.-P., Laudet V., Fruchart J.-C., Laine B. RT Full sequence of the human HNF4 cDNA RL Gene 147:269-272 (1994). RN [4]; RE0006831. RX PUBMED: 8622695. RA Drewes T., Senkel S., Holewa B., Ryffel G. U. RT Human hepatocyte nuclear factor 4 isoforms are encoded by distinct and differentially expressed genes RL Mol. Cell. Biol. 16:925-931 (1996). RN [5]; RE0006833. RX PUBMED: 8964514. RA Kritis A. A., Argyrokastritis A., Moschonas N. K., Power S., Katrakili N., Zannis V. I., Cereghini S., Talianidis I. RT Isolation and characterization of a third isoform of human hepatocyte nuclear factor 4 RL Gene 173:275-280 (1996). RN [6]; RE0021482. RX PUBMED: 12097158. RA Tsuchiya T., Kominato Y., Ueda M. RT Human Hypoxic Signal Transduction through a Signature Motif in Hepatocyte Nuclear Factor 4 RL J. Biochem. 132:37-44 (2002). RN [7]; RE0051687. RX PUBMED: 17022998. RA Eeckhoute J., Briche I., Kurowska M., Formstecher P., Laine B. RT Hepatocyte nuclear factor 4 alpha ligand binding and F domains mediate interaction and transcriptional synergy with the pancreatic islet LIM HD transcription factor Isl1. RL J. Mol. Biol. 364:567-581 (2006). RN [8]; RE0055387. RX PUBMED: 17403900. RA Sumi K., Tanaka T., Uchida A., Magoori K., Urashima Y., Ohashi R., Ohguchi H., Okamura M., Kudo H., Daigo K., Maejima T., Kojima N., Sakakibara I., Jiang S., Hasegawa G., Kim I., Osborne T. F., Naito M., Gonzalez F. J., Hamakubo T., Kodama T., Sakai J. RT Cooperative interaction between hepatocyte nuclear factor 4 alpha and GATA transcription factors regulates ATP-binding cassette sterol transporters ABCG5 and ABCG8. RL Mol. Cell. Biol. 27:4248-4260 (2007). XX //