TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01152 XX ID T01152 XX DT 26.04.1994 (created); ewi. DT 09.01.2015 (updated); spk. CO Copyright (C), QIAGEN. XX FA T3R-alpha1 XX SY c-erbA-1; EAR-7; EAR7; NR1A1; Nuclear receptor subfamily 1 group A member 1; T3R-alpha1; thyroid hormone receptor alpha; thyroid hormone receptor alpha1; TR; TR-alpha. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G004672 THRA; HGNC: THRA. XX CL C0002; CC (rec); 2.1.2.2.1.1. XX SZ 410 AA; 46.8 kDa (cDNA) (calc.). XX SQ MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKA SQ TGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGM SQ AMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNA SQ QGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFS SQ ELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIF SQ ELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNI SQ PHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFEDQEV XX SC Swiss-Prot#P10827-2 XX FT 50 123 SM00399; c4gold. FT 50 127 PS51030; NUCLEAR_REC_DBD_2. FT 51 128 PF00105; Zinc finger, C4 type (two domains). FT 83 329 PF00478; IMP dehydrogenase / GMP reductase domai. FT 220 378 SM00430; holi. FT 223 404 PF00104; Ligand-binding domain of nuclear hormon. XX SF zinc-dependent folding; SF splice variant from THRA (c-arbA-1) gene [4]; XX FF DNA-binding is zinc-dependent; XX IN T08796 ASC-2; human, Homo sapiens. IN T33929 DRIP205-isoform1; human, Homo sapiens. IN T33762 DRIP205; human, Homo sapiens. IN T10361 Oct-2; Mammalia. IN T08628 POU2F1; Mammalia. IN T01331 RXR-alpha; mouse, Mus musculus. IN T01345 RXR-alpha; human, Homo sapiens. IN T01359 RXR-alpha; clawed frog, Xenopus laevis. IN T08433 RXR-alpha; human, Homo sapiens. IN T04689 SMRT; human, Homo sapiens. IN T00818 TFIIB; human, Homo sapiens. XX MX M01724 V$T3RALPHA_Q6. MX M00963 V$T3R_Q6. XX BS R01465. BS R03939. BS R03940. BS R04765. BS R04766. BS R04767. BS R03523. BS R01906. XX DR TRANSPATH: MO000025446. DR EMBL: M24748; DR UniProtKB: P10827-2; XX RN [1]; RE0000565. RX PUBMED: 1954886. RA Miyamoto T., Sakurai A., DeGroot L. J. RT Effects of zinc and other divalent metals on deoxyribonucleic acid binding and hormone-binding activity of human alpha1 thyroid hormone receptor expressed in Escherichia coli RL Endocrinology 129:3027-3033 (1991). RN [2]; RE0001853. RX PUBMED: 2569164. RA Sap J., Munoz A., Schmitt J., Stunnenberg H., Vennstroem B. RT Repression of transcription mediated at a thyroid hormone response element by the v-erb-A oncogene product RL Nature 340:242 (1989). RN [3]; RE0001917. RX PUBMED: 1310350. RA Zhang X. K., Hoffmann B., Tran P. B.-V., Graupner G., Pfahl M. RT Retinoid X receptor is an auxiliary protein for thyroid hormone and retinoic acid receptors RL Nature 355:441-446 (1992). RN [4]; RE0002102. RX PUBMED: 1850510. RA Laudet V., Begue A., Henry-Duthoit C., Joubel A., Martin P., Stehelin D., Saule S. RT Genomic organization of the human thyroid hormone receptor alpha (c-erbA-1) gene RL Nucleic Acids Res. 19:1105-1112 (1991). RN [5]; RE0013624. RX PUBMED: 2464749. RA Nakai A., Sakurai A., Bell G. I., DeGroot L. J. RT Characterization of a third human thyroid hormone receptor coexpressed with other thyroid hormone receptors in several tissues RL Mol. Endocrinol. 2:1087-1092 (1988). RN [6]; RE0013625. RX PUBMED: 10219237. RA Nuclear Receptors Nomenclature Committee. RT A unified nomenclature system for the nuclear receptor superfamily RL Cell 97:161-163 (1999). RN [7]; RE0022655. RX PUBMED: 10982791. RA Davis P. J., Shih A., Lin H.-Y., Martino L. J., Davis F. B. RT Thyroxine promotes association of mitogen-activated protein kinase and nuclear thyroid hormone receptor (TR) and causes serine phosphorylation of TR. RL J. Biol. Chem. 275:38032-38039 (2000). RN [8]; RE0025766. RX PUBMED: 12048199. RA Lin H. M., Zhao L., Cheng S. Y. RT Cyclin D1 Is a Ligand-independent Co-repressor for Thyroid Hormone Receptors. RL J. Biol. Chem. 277:28733-41 (2002). RN [9]; RE0025974. RX PUBMED: 9653119. RA Yuan C. X., Ito M., Fondell J. D., Fu Z. Y., Roeder R. G. RT The TRAP220 component of a thyroid hormone receptor- associated protein (TRAP) coactivator complex interacts directly with nuclear receptors in a ligand-dependent fashion RL Proc. Natl. Acad. Sci. USA 95:7939-44 (1998). RN [10]; RE0047529. RX PUBMED: 11641275. RA Potter G. B., Beaudoin GM 3. r. d., DeRenzo C. L., Zarach J. M., Chen S. H., Thompson C. C. RT The hairless gene mutated in congenital hair loss disorders encodes a novel nuclear receptor corepressor. RL Genes Dev. 15:2687-2701 (2001). RN [11]; RE0047948. RX PUBMED: 10383413. RA Kakizawa T., Miyamoto T., Ichikawa K., Kaneko A., Suzuki S., Hara M., Nagasawa T., Takeda T., Mori J., Kumagai M., Hashizume K. RT Functional interaction between Oct-1 and retinoid X receptor. RL J. Biol. Chem. 274:19103-19108 (1999). RN [12]; RE0050597. RX PUBMED: 10681503. RA Caira F., Antonson P., Pelto-Huikko M., Treuter E., Gustafsson J. A. RT Cloning and characterization of RAP250, a novel nuclear receptor coactivator. RL J. Biol. Chem. 275:5308-5317 (2000). XX //