TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T05309 XX ID T05309 XX DT 24.10.2002 (created); oke. DT 30.06.2010 (updated); pch. CO Copyright (C), QIAGEN. XX FA FXR-isoform3 XX SY bile acid receptor; farnesoid X activated receptor; NR1H4. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G002745 NR1H4; HGNC: NR1H4. XX CL C0002; CC (rec); 2.1.2.7.3.3. XX SZ 476 AA; 54.9 kDa (cDNA) (calc.). XX SQ MGSKMNLIEHSHLPTTDEFSFSENLFGVLTEQVAGPLGQNLEVEPYSQYSNVQFPQVQPQ SQ ISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAETLYQGETEVAEMPVTKKPRMGASAGR SQ IKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCVMDMYMRRKCQ SQ ECRLRKCKEMGMLAECMYTGLLTEIQCKSKRLRKNVKQHADQTVNEDSEGRDLRQVTSTT SQ KSCREKTELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLILTEMATNHVQ SQ VLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSG SQ ISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQ SQ KLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ XX SC Swiss-Prot#Q96RI1-1 XX FT 124 195 SM00399; c4gold. FT 124 199 PS51030; NUCLEAR_REC_DBD_2. FT 125 200 PF00105; zf-C4. FT 293 448 SM00430; holi. FT 296 472 PF00104; Hormone_recep. XX SF at least 3 splice variants: previously known FXR-isoform3-alpha T04498, two new variants arise from the use of alternative promoter, they are different by insertion of 4 amino acids MYTG in the hinge region: FXR-isoform3-beta1 T05307 and FXR-isoform3-beta2 T05308 [4]; SF binds to DNA as a heterodimer with RXR-alpha [2] [6]; SF for the heterodimeric, see human FXR-isoform3:RXR-alpha T05313; XX FF activator as a heterodimer with RXR-alpha; FF repressor as a monomer or homodimer [5]; FF activated by natural ligands: bile acids (e.g. chenodeoxycholic acid) [1] [6]; FF artificial ligand isoxazole GW4064 is a very potent and selective activator [3]; FF FXR-isoform3 plays a key role in bile acid synthesis and transport [6]; FF activator of SPH-1 gene, ileal bile acid binding protein gene [6]; FF negatively regulates bile acid production by indirect decreasing transcription of CYP7A [6]; FF regulates lipoprotein metabolism [5]; XX IN T05309 FXR-isoform3; human, Homo sapiens. IN T01331 RXR-alpha; mouse, Mus musculus. IN T01345 RXR-alpha; human, Homo sapiens. XX MX M07256 V$FXRRXR_Q5. MX M01268 V$FXR_Q2. MX M00631 V$FXR_Q3. MX M03790 V$FXR_Q5. MX M03795 V$LXR_Q6. MX M00964 V$PXR_Q2. XX BS R13075. BS R22781. BS R31809. BS R16486. BS R19369. XX DR TRANSPATH: MO000033914. DR EMBL: AF384555; DR UniProtKB: Q96RI1-1; XX RN [1]; RE0016194. RX PUBMED: 10334993. RA Parks D. J., Blanchard S. G., Bledsoe R. K., Chandra G., Consler T. G., Kliewer S. A., Stimmel J. B., Willson T. M., Zavacki A. M., Moore D. D., Lehmann J. M. RT Bile acids: natural ligands for an orphan nuclear receptor RL Science 284:1365-1368 (1999). RN [2]; RE0016195. RX PUBMED: 10514450. RA Grober J., Zaghini I., Fujii H., Jones S. A., Kliewer S. A., Willson T. M., Ono T., Besnard P. RT Identification of a bile acid-responsive element in the human ileal bile acid-binding protein gene. Involvement of the farnesoid X receptor/9-cis-retinoic acid receptor heterodimer RL J. Biol. Chem. 274:29749-29754 (1999). RN [3]; RE0016409. RX PUBMED: 11030332. RA Goodwin B., Jones S. A., Price R. R., Watson M. A., McKee D. D., Moore L. B., Galardi C., Wilson J. G., Lewis M. C., Roth M. E., Maloney P. R., Willson T. M., Kliewer S. A. RT A regulatory cascade of the nuclear receptors FXR, SHP-1, and LRH-1 represses bile acid biosynthesis RL Mol. Cell 6:517-526 (2000). RN [4]; RE0018089. RX PUBMED: 12062799. RA Huber R. M., Murphy K., Miao B., Link J. R., Cunningham M. R., Rupar M. J., Gunyuzlu P. L., Haws T. F., Kassam A., Powell F., Hollis G. F., Young P. R., Mukherjee R., Burn T. C. RT Generation of multiple farnesoid-X-receptor isoforms through the use of alternative promoters. RL Gene 290:35-43 (2002). RN [5]; RE0018100. RX PUBMED: 11927623. RA Claudel T., Sturm E., Duez H., Torra I. P., Sirvent A., Kosykh V., Fruchart J.-C., Dallongeville J., Hum D. W., Kuipers F., Staels B. RT Bile acid-activated nuclear receptor FXR suppresses apolipoprotein A-I transcription via a negative FXR response element. RL J. Clin. Invest. 109:961-971 (2002). RN [6]; RE0023349. RX PUBMED: 10334992. RA Makishima M., Okamoto A. Y., Repa J. J., Tu H., Learned R. M., Luk A., Hull M. V., Lustig K. D., Mangelsdorf D. J., Shan B. RT Identification of a nuclear receptor for bile acids. RL Science 284:1362-1365 (1999). XX //