TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T06002 XX ID T06002 XX DT 07.06.2004 (created); cch. DT 30.07.2014 (updated); sla. CO Copyright (C), QIAGEN. XX FA DeltaNp73alpha XX SY DeltaN p73 alpha; DeltaTA-p73alpha; DN p73 alpha; hDNp73A; NH2-terminally truncated p73alpha; p73Deltaexon2; TAD-truncated form of p73alpha; transactivation deficient p73alpha; tumor protein p73 isoform b. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G005523 TP73; HGNC: tp73. XX CL C0057; P53; 6.3.1.0.3.7. XX SZ 587 AA; 64.4 kDa (calc.). XX SQ MLYVGDPARHLATAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTM SQ SPAPVIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPP SQ PPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDP SQ VTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRS SQ FEGRICACPGRDRKADEDHYREQQALNESSAKNGAASKRAFKQSPPAVPALGAGVKKRRH SQ GDEDTYYLQVRGRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQRPSHLQPPSYGP SQ VLSPMNKVHGGMNKLPSVNQLVGQPPPHSSAATPNLGPVGPGMLNNHGHAVPANGEMSSS SQ HSAQSMVSGSHCTPPPPYHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLG SQ ALKIPEQYRMTIWRGLQDLKQGHDYSTAQQLLRSSNAATISIGGSGELQRQRVMEAVHFR SQ VRHTITIPNRGGPGGGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH XX SC translated from EMBL #AB055065 XX FT 13 81 PRD, proline-rich domain (10/69) [7]. FT 53 534 PF00478; IMP dehydrogenase / GMP reductase domain. FT 64 260 PF00870; P53 DNA-binding domain. FT 82 260 DBD [7]. FT 296 337 PF07710; P53 tetramerisation motif. FT 302 331 OD, oligomerization domain [7]. FT 436 502 PF07647; SAM domain (Sterile alpha motif). FT 436 502 SM00454; SAM. FT 438 504 SAM [7]. XX SF several alternative products are known, p73alpha T04931, p73beta T06137, p73gamma T06142, p73delta T06143, p73epsilon T06144, p73zeta T06145, p73kappa T06139, p73eta T06179, DeltaN p73alpha T06002, DeltaN p73beta T06003, DeltaNp73gamma T06013; SF this isoform lack N-terminal transactivation domain [1]; XX CP initially detected in neuroblastoma cell line. XX FF suppressor of p53, TAp73 variants and TAp63 forms, block their transactivation potential and induction of apoptosis [1] [2] [3] [6] [10]; FF proposed to establish a feedback loop that controls the activity of p53 [10]; FF activates promoters carrying HSE (heat shock response elements) by increasing of HSF1 binding to HSE [7]; FF acts as an oncogene [3] [9]; FF inactive in suppressing cell growth [4]; FF mRNA is induced by p73alpha thus forming a negative regulatory feedback loop [2] [5]; XX MX M00761 V$P53DECAMER_Q2. MX M03558 V$P73_Q6. XX BS R16694. XX DR TRANSPATH: MO000043788. DR EMBL: AB055065; DR UniProtKB: O15350-8; XX RN [1]; RE0024719. RX PUBMED: 11753569. RA Grob T. J., Novak U., Maisse C., Barcaroli D., Luthi A. U., Pirnia F., Hugli B., Graber H. U., De Laurenzi V., Fey M. F., Melino G., Tobler A. RT Human delta Np73 regulates a dominant negative feedback loop for TAp73 and p53. RL Cell Death Differ. 8:1213-1223 (2001). RN [2]; RE0024741. RX PUBMED: 11909952. RA Nakagawa T., Takahashi M., Ozaki T., Watanabe Ki K., Todo S., Mizuguchi H., Hayakawa T., Nakagawara A. RT Autoinhibitory regulation of p73 by Delta Np73 to modulate cell survival and death through a p73-specific target element within the Delta Np73 promoter. RL Mol. Cell. Biol. 22:2575-2585 (2002). RN [3]; RE0024754. RX PUBMED: 11313982. RA Fillippovich I., Sorokina N., Gatei M., haupt Y., Hobson K., Moallem E., Spring K., Mould M., McGuckin M. A., Lavin M. F., Khanna K. K. RT Transactivation-deficient p73alpha (p73Deltaexon2) inhibits apoptosis and competes with p53. RL Oncogene 20:514-522 (2001). RN [4]; RE0024755. RX PUBMED: 14701724. RA Liu G., Nozell S., Xiao H., Chen X. RT DeltaNp73beta is active in transactivation and growth suppression. RL Mol. Cell. Biol. 24:487-501 (2004). RN [5]; RE0024774. RX PUBMED: 12032848. RA Vossio S., Palescandolo E., Pediconi N., Moretti F., Balsano C., Levrero M., Costanzo A. RT DN-p73 is activated after DNA damage in a p53-dependent manner to regulate p53-induced cell cycle arrest. RL Oncogene 21:3796-3803 (2002). RN [6]; RE0024778. RX PUBMED: 11844800. RA Stiewe T., Theseling C. C., Putzer B. M. RT Transactivation-deficient Delta TA-p73 inhibits p53 by direct competition for DNA binding: implications for tumorigenesis. RL J. Biol. Chem. 277:14177-14185 (2002). RN [7]; RE0024793. RX PUBMED: 15081420. RA Tanaka Y., Kameoka M., Itaya A., Ota K., Yoshihara K. RT Regulation of HSF1-responsive gene expression by N-terminal truncated form of p73alpha. RL Biochem. Biophys. Res. Commun. 317:865-872 (2004). RN [8]; RE0024800. RX PUBMED: 11830511. RA Ishimoto O., Kawahara C., Enjo K., Obinata M., Nukiwa T., Ikawa S. RT Possible oncogenic potential of DeltaNp73: a newly identified isoform of human p73. RL Cancer Res. 62:636-641 (2002). RN [9]; RE0024805. RX PUBMED: 12097259. RA Stiewe T., Zimmermann S., Frilling A., Esche H., Putzer B. M. RT Transactivation-deficient DeltaTA-p73 acts as an oncogene. RL Cancer Res. 62:3598-3602 (2002). RN [10]; RE0035160. RX PUBMED: 12101410. RA Kartasheva N. N., Contente A., Lenz-Stoeppler C., Roth J., Dobbelstein M. RT p53 induces the expression of its antagonist p73 Delta N, establishing an autoregulatory feedback loop. RL Oncogene 21:4715-4727 (2002). RN [11]; RE0049678. RX PUBMED: 15572666. RA Munarriz E., Barcaroli D., Stephanou A., Townsend P. A., Maisse C., Terrinoni A., Neale M. H., Martin S. J., Latchman D. S., Knight R. A., Melino G., De Laurenzi V. RT PIAS-1 is a checkpoint regulator which affects exit from G1 and G2 by sumoylation of p73. RL Mol. Cell. Biol. 24:10593-10610 (2004). XX //