TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T06003 XX ID T06003 XX DT 07.06.2004 (created); cch. DT 30.07.2014 (updated); sla. CO Copyright (C), QIAGEN. XX FA DeltaNp73beta XX SY DeltaN p73 beta; DeltaTA-p73beta; DN p73 beta; hDNp73B; NH2-terminally truncated p73beta; p73betaDeltaexon2; transactivation deficient p73beta; tumor protein p73 isoform c. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G005523 TP73; HGNC: tp73. XX CL C0057; P53; 6.3.1.0.3.8. XX SZ 450 AA; 49.1 kDa (calc.). XX SQ MLYVGDPARHLATAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTM SQ SPAPVIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPP SQ PPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDP SQ VTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRS SQ FEGRICACPGRDRKADEDHYREQQALNESSAKNGAASKRAFKQSPPAVPALGAGVKKRRH SQ GDEDTYYLQVRGRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQRPSHLQPPSYGP SQ VLSPMNKVHGGMNKLPSVNQLVGQPPPHSSAATPNLGPVGPGMLNNHGHAVPANGEMSSS SQ HSAQSMVSGSHCTPPPPYHADPSLVRTWGP XX SC translated from EMBL #AB055066 XX FT 1 13 new type of transactivation domain, together with PXXP motifs [3]. FT 35 38 PXXP motif [3]. FT 53 342 PF00478; IMP dehydrogenase / GMP reductase domain. FT 64 67 PXXP motif [3]. FT 64 260 PF00870; P53 DNA-binding domain. FT 296 337 PF07710; P53 tetramerisation motif. XX SF several alternative products are known, p73alpha T04931, p73beta T06137, p73gamma T06142, p73delta T06143, p73epsilon T06144, p73zeta T06145, p73kappa T06139, p73eta T06179, DeltaN p73alpha T06002, DeltaN p73beta T06003, DeltaNp73gamma T06013; SF this isoform lack N-terminal transactivation domain of p73beta [1]; SF 1-13 AA together with N-terminal PXXP motifs constitute a novel activation domain of DeltaN p73beta [3]; XX FF is able to activate transcription, although not so strongly as p73beta [3]; FF can activate genes p21, Mdm2, 14-3-3sigma, GADD45 [3]; FF suppressor of p53, TAp73 variants and TAp63 form, blocks their transactivation potential [1] [2] [4] [7]; FF suppression is less pronounced compared to DeltaN p73 alpha [7]; FF proposed to establish a feedback loop that controls the activity of p53 [7]; FF previously thought to block induction of apoptosis [1]; FF is able to induce cell cycle arrest and apoptosis [3]; FF may act as oncogene [6]; XX MX M00761 V$P53DECAMER_Q2. MX M03558 V$P73_Q6. XX BS R16694. XX DR TRANSPATH: MO000043789. DR EMBL: AB055066; DR UniProtKB: O15350-9; XX RN [1]; RE0024719. RX PUBMED: 11753569. RA Grob T. J., Novak U., Maisse C., Barcaroli D., Luthi A. U., Pirnia F., Hugli B., Graber H. U., De Laurenzi V., Fey M. F., Melino G., Tobler A. RT Human delta Np73 regulates a dominant negative feedback loop for TAp73 and p53. RL Cell Death Differ. 8:1213-1223 (2001). RN [2]; RE0024741. RX PUBMED: 11909952. RA Nakagawa T., Takahashi M., Ozaki T., Watanabe Ki K., Todo S., Mizuguchi H., Hayakawa T., Nakagawara A. RT Autoinhibitory regulation of p73 by Delta Np73 to modulate cell survival and death through a p73-specific target element within the Delta Np73 promoter. RL Mol. Cell. Biol. 22:2575-2585 (2002). RN [3]; RE0024755. RX PUBMED: 14701724. RA Liu G., Nozell S., Xiao H., Chen X. RT DeltaNp73beta is active in transactivation and growth suppression. RL Mol. Cell. Biol. 24:487-501 (2004). RN [4]; RE0024778. RX PUBMED: 11844800. RA Stiewe T., Theseling C. C., Putzer B. M. RT Transactivation-deficient Delta TA-p73 inhibits p53 by direct competition for DNA binding: implications for tumorigenesis. RL J. Biol. Chem. 277:14177-14185 (2002). RN [5]; RE0024800. RX PUBMED: 11830511. RA Ishimoto O., Kawahara C., Enjo K., Obinata M., Nukiwa T., Ikawa S. RT Possible oncogenic potential of DeltaNp73: a newly identified isoform of human p73. RL Cancer Res. 62:636-641 (2002). RN [6]; RE0024805. RX PUBMED: 12097259. RA Stiewe T., Zimmermann S., Frilling A., Esche H., Putzer B. M. RT Transactivation-deficient DeltaTA-p73 acts as an oncogene. RL Cancer Res. 62:3598-3602 (2002). RN [7]; RE0035160. RX PUBMED: 12101410. RA Kartasheva N. N., Contente A., Lenz-Stoeppler C., Roth J., Dobbelstein M. RT p53 induces the expression of its antagonist p73 Delta N, establishing an autoregulatory feedback loop. RL Oncogene 21:4715-4727 (2002). XX //