TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T06375 XX ID T06375 XX DT 15.12.2004 (created); cch. DT 22.10.2009 (updated); bjo. CO Copyright (C), QIAGEN. XX FA ING1b XX SY growth inhibitor ING1; ING1; ING1-isoform2; ING1-Variant A; inhibitor of growth 1; inhibitor of growth family, member 1; inhibitor of growth protein 1; p33ING1b; tumor suppressor ING1. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G013653 ING1; HGNC: ING1. XX SZ 279 AA; 31.9 kDa (cDNA) (calc.). XX SQ MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDECYERFSR SQ ETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELG SQ DTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKK SQ AKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSC SQ VGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR XX SC translated from EMBL:AF181850 XX FT 210 259 PS50016; ZF_PHD_2. FT 212 257 SM00249; PHD_3. FT 212 259 PF00628; PHD-finger. XX FF ING1b stabilizes p53 likely by decreasing binding of p53 to Mdm2 and enhances transcriptional and growth-inhibitory activity of p53 [2]; XX IN T18378 CBP; human, Homo sapiens. IN T00261 ER-alpha; human, Homo sapiens. IN T21852 HDAC1; Mammalia. IN T21984 p300; human, Homo sapiens. IN T00671 p53; human, Homo sapiens. IN T29717 SIRT1; human, Homo sapiens. IN T30703 SIRT1; Mammalia. XX DR TRANSPATH: MO000045001. DR EMBL: AF181850; DR UniProtKB: Q9UK53-2; XX RN [1]; RE0025249. RX PUBMED: 14522900. RA Kataoka H., Bonnefin P., Vieyra D., Feng X., Hara Y., Miura Y., Joh T., Nakabayashi H., Vaziri H., Harris C. C., Riabowol K. RT ING1 represses transcription by direct DNA binding and through effects on p53. RL Cancer Res. 63:5785-5792 (2003). RN [2]; RE0025251. RX PUBMED: 12208736. RA Leung K. M., Po L. S., Tsang F. C., Siu W. Y., Lau A., Ho H. T., Poon R. Y. RT The candidate tumor suppressor ING1b can stabilize p53 by disrupting the regulation of p53 by MDM2. RL Cancer Res. 62:4890-4893 (2002). RN [3]; RE0029643. RX PUBMED: 12015309. RA Vieyra D., Loewith R., Scott M., Bonnefin P., Boisvert F. M., Cheema P., Pastyryeva S., Meijer M., Johnston R. N., Bazett-Jones D. P., McMahon S., Cole M. D., Young D., Riabowol K. RT Human ING1 proteins differentially regulate histone acetylation. RL J. Biol. Chem. 277:29832-9 (2002). RN [4]; RE0036018. RX PUBMED: 14630091. RA Toyama T., Iwase H., Yamashita H., Hara Y., Sugiura H., Zhang Z., Fukai I., Miura Y., Riabowol K., Fujii Y. RT p33(ING1b) stimulates the transcriptional activity of the estrogen receptor alpha via its activation function (AF) 2 domain. RL J. Steroid Biochem. Mol. Biol. 87:57-63 (2003). RN [5]; RE0047881. RX PUBMED: 15451426. RA Nikolaev A. Y., Papanikolaou N. A., Li M., Qin J., Gu W. RT Identification of a novel BRMS1-homologue protein p40 as a component of the mSin3A/p33(ING1b)/HDAC1 deacetylase complex. RL Biochem. Biophys. Res. Commun. 323:1216-1222 (2004). RN [6]; RE0049287. RX PUBMED: 16607280. RA Gonzalez L., Freije J. M., Cal S., Lopez-Otin C., Serrano M., Palmero I. RT A functional link between the tumour suppressors ARF and p33ING1. RL Oncogene 25:5173 (2006). RN [7]; RE0064434. RX PUBMED: 18193082. RA Binda O., Nassif C., Branton P. E. RT SIRT1 negatively regulates HDAC1-dependent transcriptional repression by the RBP1 family of proteins. RL Oncogene 27:3384-3392 (2008). XX //