AC T00788
XX
ID T00788
XX
DT 15.10.1992 (created); ewi.
DT 30.04.2010 (updated); pos.
CO Copyright (C), QIAGEN.
XX
FA T-Ag
XX
SY large T antigen; T-Ag.
XX
OS SV40, simian virus 40
OC viridae; ds-DNA nonenveloped viruses; papovaviridae; polyomaviruses
XX
CL C0001; CH.
XX
SZ 708 AA; 81.6 kDa (calc.), 100 kDa
XX
SQ MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYK
SQ KMEDGVKYAHQPDFGGFWDATEIPTYGTDEWEQWWNAFNEENLFCSEEMPSSDDEATADS
SQ QHSTPPKKKRKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYS
SQ VTFISRHNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDP
SQ FSVIEESLPGGLKEHDFNPEEAEETKQVSWKLVTEYAMETKCDDVLLLLGMYLEFQYSFE
SQ MCLKCIKKEQPSHYKYHEKHYANAAIFADSKNQKTICQQAVDTVLAKKRVDSLQLTREQM
SQ LTNRFNDLLDRMDIMFGSTGSADIEEWMAGVAWLHCLLPKMDSVVYDFLKCMVYNIPKKR
SQ YWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFELGVAIDQFLVVFEDVKGTGG
SQ ESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFTPGIVTMNEFSVPKTLQAR
SQ FVKQIDFRAKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWK
SQ ERLDKEFSLSVYQKMKFNVAMGIGVLDWLRNSDDDDEDSQENADKNEDGGEKNMEDSGHE
SQ TGIDSQSQGSFQAPQSSQSVHDHNQPYHICRGFTCFKKPPTPPPEPET
XX
FT 11 67 
SM00271; dnaj_3.
FT 12 75 
PF00226; DnaJ domain.
FT 12 75 
PS50076; DNAJ_2.
FT 105 114 
Rb binding [11].
FT 137 258 
PF02217; Origin of replication binding protein.
FT 253 555 
PF00478; IMP dehydrogenase / GMP reductase doma.
FT 265 699 
PF06431; Polyomavirus large T antigen C-terminu.
XX
SF 1 zinc finger motif [4];
SF T-Ag complexes with un- (or under-) phosphorylated Rb (p110) but not with hyperphosphorylated Rb (p112-114) [12] [13] [14];
SF complexing of T-Ag with p107 allows binding of SV40 ori, but not of DNA polymerase alpha, therefore preventing SV40 replication [7];
XX
FF sequence 101-119 in T-Ag can functionally substitute for deletion of CR2 in adenovirus E1A T00209 T00967 [19];
XX
IN T01486 p107; human, Homo sapiens.
IN T01608 p130; human, Homo sapiens.
IN T00671 p53; human, Homo sapiens.
IN T01806 p53; mouse, Mus musculus.
IN T00656 POU3F1; mouse, Mus musculus.
IN T00722 pRb; human, Homo sapiens.
IN T02374 Rb; monkey, Cercopithecus aethiops.
XX
BS R01234.
BS R01238.
BS R01241.
BS R01242.
BS R01243.
BS R01244.
BS R01823.
BS R01369.
BS R01370.
BS R01372.
BS R08153.
XX
DR TRANSPATH: MO000023609.
DR EMBL: J02400; SVCG.
DR EMBL: V01380; SV40XX.
DR UniProtKB: P03070; TALA_SV40.
XX
RN [1]; RE0000105.
RX PUBMED: 3040262.
RA Mitchell P., Wang C., Tjian R.
RT Positive and Negative Regulation of Transcription In Vitro: Enhancer-Binding Protein AP-2 Is Inhibited by SV40 T Antigen
RL Cell 50:847-861 (1987).
RN [2]; RE0001150.
RX PUBMED: 6092707.
RA Cowie A., Kamen R.
RT Multiple Binding Sites for Polyomavirus Large T Antigen Within Regulatory Sequences of Polyomavirus DNA
RL J. Virol. 52:750-760 (1984).
RN [3]; RE0001151.
RX PUBMED: 6298451.
RA DeLucia A. L., Lewton B. A., Tjian R., Tegtmeyer P.
RT Topography of Simian Virus 40 A Protein-DNA Complexes: Arrangement of Pentanucleotide Interaction Sites at the Origin of Replication
RL J. Virol. 46:143-150 (1983).
RN [4]; RE0001171.
RX PUBMED: 1851875.
RA Loeber G., Stenger J. E., Ray S., Parsons R. E., Anderson M. E., Tegtmeyer P.
RT The zinc finger region of simian virus 40 large T antigen is needed for hexamer assembly and origin melting
RL J. Virol. 65:3167-3174 (1991).
RN [5]; RE0001414.
RX PUBMED: 2555700.
RA McVey D., Strauss M., Gluzman Y.
RT Properties of the DNA-Binding Domain of the Simian Virus 40 Large T Antigen
RL Mol. Cell. Biol. 9:5525-5536 (1989).
RN [6]; RE0002342.
RX PUBMED: 6326093.
RA Dilworth S. M., Cowie A., Kamen R. I., Griffin B. E.
RT DNA binding activity of polyoma virus large tumor antigen
RL Proc. Natl. Acad. Sci. USA 81:1941-1945 (1984).
RN [7]; RE0008808.
RX PUBMED: 8126000.
RA Amin A. A., Murakami Y., Hurwitz J.
RT Initiation of DNA replication by simian virus 40 T antigen is inhibited by the p107 protein
RL J. Biol. Chem. 269:7735-7742 (1994).
RN [8]; RE0012978.
RX PUBMED: 6269743.
RA Myers R. M., Rio D. C., Robbins A. K., Tjian R.
RT SV40 gene expression is modulated by the cooperative binding of T antigen to DNA.
RL Cell 25:373-384 (1981).
RN [9]; RE0013279.
RX PUBMED: 6298452.
RA Tegtmeyer P., Lewton B. A., DeLucia A. L., Wilson V. G., Ryder K.
RT Topography of simian virus 40 A protein-DNA complexes: arrangement of protein bound to the origin of replication.
RL J. Virol. 46:151-161 (1983).
RN [10]; RE0013301.
RX PUBMED: 2138977.
RA Hu Q. J., Dyson N., Harlow E.
RT The regions of the retinoblastoma protein needed for binding to adenovirus E1A or SV40 large T antigen are common sites for mutations.
RL EMBO J. 9:1147-1155 (1990).
RN [11]; RE0013304.
RX PUBMED: 2839300.
RA DeCaprio J. A., Ludlow J. W., Figge J., Shew J.-Y., Huang C.-M., Lee W.-H., Marsilio E., Paucha E., Livingston D. M.
RT SV40 large tumor antigen forms a specific complex with the product of the retinoblastoma susceptibility gene.
RL Cell 54:275-283 (1988).
RN [12]; RE0013305.
RX PUBMED: 2910497.
RA Ludlow J. W., DeCaprio J. A., Huang C.-M., Lee W.-H., Paucha E., Livingston D. M.
RT SV40 large T antigen binds preferentially to an underphosphorylated member of the retinoblastoma susceptibility gene product family.
RL Cell 56:57-65 (1989).
RN [13]; RE0013306.
RX PUBMED: 2673542.
RA DeCaprio J. A., Ludlow J. W., Lynch D., Furukawa Y., Griffin J., Piwnica-Worms H., Huang C.-M., Livingston D. M.
RT The product of the retinoblastoma susceptibility gene has properties of a cell cycle regulatory element.
RL Cell 58:1085-1095 (1989).
RN [14]; RE0013307.
RX PUBMED: 2154332.
RA Ludlow J. W., Shon J., Pipas J. M., Livingston D. M., DeCaprio J. A.
RT The retinoblastoma susceptibility gene product undergoes cell cycle-dependent dephosphorylation and binding to and release from SV40 large T.
RL Cell 60:387-396 (1990).
RN [15]; RE0013308.
RX PUBMED: 2526683.
RA Ewen M. E., Ludlow J. W., Marsilio E., DeCaprio J. A., Millikan R. C., Cheng S. H., Paucha E., Livingston D. M.
RT An N-terminal transformation-governing sequence of SV40 large T antigen contributes to the binding of both p110Rb and a second cellular protein, p120.
RL Cell 58:257-267 (1989).
RN [16]; RE0013309.
RX PUBMED: 2546678.
RA Dyson N., Buchkovich K., Whyte P., Harlow E.
RT The cellular 107K protein that binds to adenovirus E1A also associates with the large T antigens of SV40 and JC virus.
RL Cell 58:249-255 (1989).
RN [17]; RE0013310.
RX PUBMED: 1833063.
RA Ewen M. E., Xing Y. G., Lawrence J. B., Livingston D. M.
RT Molecular cloning, chromosomal mapping, and expression of the cDNA for p107, a retinoblastoma gene product-related protein.
RL Cell 66:1155-1164 (1991).
RN [18]; RE0013312.
RX PUBMED: 6093377.
RA Kalderon D., Smith A. E.
RT In vitro mutagenesis of a putative DNA binding domain of SV40 large-T.
RL Virology 139:109-137 (1984).
RN [19]; RE0013313.
RX PUBMED: 2968523.
RA Moran E.
RT A region of SV40 large T antigen can substitute for a transforming domain of the adenovirus E1A products.
RL Nature 334:168-170 (1988).
RN [20]; RE0013314.
RX PUBMED: 3000772.
RA Stabel S., Argos P., Philipson L.
RT The release of growth arrest by microinjection of adenovirus E1A DNA.
RL EMBO J. 4:2329-2336 (1985).
RN [21]; RE0021155.
RX PUBMED: 11707411.
RA Wang T., Kobayashi T., Takimoto R., Denes A. E., Snyder E. L., El-Deiry W. S., Brachmann R.
RT hADA3 is required for p53 activity
RL EMBO J. 20:6404-6413 (2001).
RN [22]; RE0025231.
RX PUBMED: 11340159.
RA Xing J., Sheppard H. M., Corneillie S. I., Liu X.
RT p53 Stimulates TFIID-TFIIA-promoter complex assembly, and p53-T antigen complex inhibits TATA binding protein-TATA interaction.
RL Mol. Cell. Biol. 21:3652-3661 (2001).
RN [23]; RE0066585.
RX PUBMED: 19671663.
RA Tei S., Saitoh N., Funahara T., Iida S., Nakatsu Y., Kinoshita K., Kinoshita Y., Saya H., Nakao M.
RT Simian virus 40 large T antigen targets the microtubule-stabilizing protein TACC2.
RL J. Cell Sci. 122:3190-3198 (2009).
XX
//