
AC   T00888
XX
ID   T00888
XX
DT   12.03.1993 (created); ewi.
DT   28.08.2007 (updated); apk.
CO   Copyright (C), QIAGEN.
XX
FA   v-Fos
XX
SY   gag-fos; v-Fos.
XX
OS   FBR MuLV, FBR murine osteosarcoma virus
OC   viridae; ss-RNA enveloped viruses; positive strand RNA viruses; retroviridae; oncovirinae; type C oncovirus group; mammalian type C oncoviruses
XX
CL   C0008; bZIP.
XX
SZ   244 AA; 26.6 kDa (gene) (calc.).
XX
SQ   DSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANFIPTETAISTSPDLQWLVQPTLVSS
SQ   VAPSQTRAPHPYGLPTQSAGAYARAGMVKTVSGGRAQSIGRRGKVEQLSPEEEVKRRIRR
SQ   ERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPAC
SQ   KIPDDLGFPEEMSVASLDLTGGLLPLLNDPEPKPSLEPVKSSFDDFLFPASSGHSGFISM
SQ   AGWQ
XX
FT       36     60    N-terminal transcription activation domain (N-TA, by homology) [6].
FT      111    175
   N-terminal transcription activation domain (N-TA, by homology) [6].
FT      111    175    PF00170; bZIP transcription factor.
FT      111    175
   PF00170; bZIP transcription factor.
FT      111    175    SM00338; brlzneu.
FT      113    176
   SM00338; brlzneu.
FT      113    176    PS50217; BZIP.
   PS50217; BZIP.
 XX
SF   expressed as a gag-fos fusion protein of 75 kDa [3];
XX
FF   activator [7];
FF   nuclear translocation appears not to be controlled by external signals (in contrast to c-Fos) [5];
FF   trans-activation by and DNA-binding of the gag-fos fusion protein is decreased compared with c-Fos due to N-terminal myristylation [1];
FF   transformation by FBR, however, depends on the gag-fos myristylation [7];
FF   activation of the alpha(III) collagen promoter operates through interaction of a negative regulatory region with C/EBPalpha [7];
XX
IN   T00131 c-Jun; mouse, Mus musculus.
IN   T00132 c-Jun; rat, Rattus norvegicus.
IN   T00133 c-Jun; human, Homo sapiens.
IN   T00134 c-Jun; chick, Gallus gallus.
IN   T00135 c-Jun; hamster, Cricetulus sp.
IN   T01436 MafF; chick, Gallus gallus.
IN   T01437 MafG; chick, Gallus gallus.
IN   T01434 MafK; chick, Gallus gallus.
IN   T01435 MafK; mouse, Mus musculus.
IN   T01430 v-Maf; AS42, avian musculoaponeurotic fibrosarcoma virus.
XX
BS   R02963.
BS   R04116.
XX
DR   TRANSPATH: MO000025247.
DR   EMBL: K02712;
DR   UniProtKB: P29176;
XX
RN   [1]; RE0001581.
RX   PUBMED: 1846672.
RA   Kamata N., Jotte R. M., Holt J. T.
RT   Myristylation alters DNA-binding activity and transactivation of FBR (gag-fos) protein
RL   Mol. Cell. Biol. 11:765-772 (1991).
RN   [2]; RE0002917.
RX   PUBMED: 8264639.
RA   Kataoka K., Noda M., Nishizawa M.
RT   Maf  nuclear oncoprotein recognizes sequences related to an AP-1 site and forms heterodimers with both Fos and Jun
RL   Mol. Cell. Biol. 14:700-712 (1994).
RN   [3]; RE0004800.
RX   PUBMED: 6203214.
RA   Curran T., Verma I. M.
RT   FBR murine osteosarcoma virus
RL   Virology 135:218-228 (1984).
RN   [4]; RE0004801.
RX   PUBMED: 6383726.
RA   Mueller R., Verma I. M.
RT   Expression of cellular oncogenes
RL   Curr. Top. Microbiol. Immunol. 112:73-115 (1984).
RN   [5]; RE0004830.
RX   PUBMED: 2119889.
RA   Roux P., Blanchard J.-M., Fernandez A., Lamb N., Jeanteur P., Piechaczyk M.
RT   Nuclear localization of c-Fos, but not v-Fos proteins, is controlled by extracellular signals
RL   Cell 63:341-351 (1990).
RN   [6]; RE0004887.
RX   PUBMED: 8137828.
RA   Jooss K. U., Funk M., Mueller R.
RT   An autonomous N-terminal transactivation domain in Fos protein plays a crucial role in transformation
RL   EMBO J. 13:1467-1475 (1994).
RN   [7]; RE0007060.
RX   PUBMED: 8206947.
RA   Jotte R. M., Kamata N., Holt J. T.
RT   Myristylation-dependent transactivation by FBR v-fos is regulated by C/EBP
RL   J. Biol. Chem. 269:16383-16396 (1994).
XX
//
XX
SF   expressed as a gag-fos fusion protein of 75 kDa [3];
XX
FF   activator [7];
FF   nuclear translocation appears not to be controlled by external signals (in contrast to c-Fos) [5];
FF   trans-activation by and DNA-binding of the gag-fos fusion protein is decreased compared with c-Fos due to N-terminal myristylation [1];
FF   transformation by FBR, however, depends on the gag-fos myristylation [7];
FF   activation of the alpha(III) collagen promoter operates through interaction of a negative regulatory region with C/EBPalpha [7];
XX
IN   T00131 c-Jun; mouse, Mus musculus.
IN   T00132 c-Jun; rat, Rattus norvegicus.
IN   T00133 c-Jun; human, Homo sapiens.
IN   T00134 c-Jun; chick, Gallus gallus.
IN   T00135 c-Jun; hamster, Cricetulus sp.
IN   T01436 MafF; chick, Gallus gallus.
IN   T01437 MafG; chick, Gallus gallus.
IN   T01434 MafK; chick, Gallus gallus.
IN   T01435 MafK; mouse, Mus musculus.
IN   T01430 v-Maf; AS42, avian musculoaponeurotic fibrosarcoma virus.
XX
BS   R02963.
BS   R04116.
XX
DR   TRANSPATH: MO000025247.
DR   EMBL: K02712;
DR   UniProtKB: P29176;
XX
RN   [1]; RE0001581.
RX   PUBMED: 1846672.
RA   Kamata N., Jotte R. M., Holt J. T.
RT   Myristylation alters DNA-binding activity and transactivation of FBR (gag-fos) protein
RL   Mol. Cell. Biol. 11:765-772 (1991).
RN   [2]; RE0002917.
RX   PUBMED: 8264639.
RA   Kataoka K., Noda M., Nishizawa M.
RT   Maf  nuclear oncoprotein recognizes sequences related to an AP-1 site and forms heterodimers with both Fos and Jun
RL   Mol. Cell. Biol. 14:700-712 (1994).
RN   [3]; RE0004800.
RX   PUBMED: 6203214.
RA   Curran T., Verma I. M.
RT   FBR murine osteosarcoma virus
RL   Virology 135:218-228 (1984).
RN   [4]; RE0004801.
RX   PUBMED: 6383726.
RA   Mueller R., Verma I. M.
RT   Expression of cellular oncogenes
RL   Curr. Top. Microbiol. Immunol. 112:73-115 (1984).
RN   [5]; RE0004830.
RX   PUBMED: 2119889.
RA   Roux P., Blanchard J.-M., Fernandez A., Lamb N., Jeanteur P., Piechaczyk M.
RT   Nuclear localization of c-Fos, but not v-Fos proteins, is controlled by extracellular signals
RL   Cell 63:341-351 (1990).
RN   [6]; RE0004887.
RX   PUBMED: 8137828.
RA   Jooss K. U., Funk M., Mueller R.
RT   An autonomous N-terminal transactivation domain in Fos protein plays a crucial role in transformation
RL   EMBO J. 13:1467-1475 (1994).
RN   [7]; RE0007060.
RX   PUBMED: 8206947.
RA   Jotte R. M., Kamata N., Holt J. T.
RT   Myristylation-dependent transactivation by FBR v-fos is regulated by C/EBP
RL   J. Biol. Chem. 269:16383-16396 (1994).
XX
//