TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00888 XX ID T00888 XX DT 12.03.1993 (created); ewi. DT 28.08.2007 (updated); apk. CO Copyright (C), QIAGEN. XX FA v-Fos XX SY gag-fos; v-Fos. XX OS FBR MuLV, FBR murine osteosarcoma virus OC viridae; ss-RNA enveloped viruses; positive strand RNA viruses; retroviridae; oncovirinae; type C oncovirus group; mammalian type C oncoviruses XX CL C0008; bZIP. XX SZ 244 AA; 26.6 kDa (gene) (calc.). XX SQ DSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANFIPTETAISTSPDLQWLVQPTLVSS SQ VAPSQTRAPHPYGLPTQSAGAYARAGMVKTVSGGRAQSIGRRGKVEQLSPEEEVKRRIRR SQ ERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPAC SQ KIPDDLGFPEEMSVASLDLTGGLLPLLNDPEPKPSLEPVKSSFDDFLFPASSGHSGFISM SQ AGWQ XX FT 36 60 N-terminal transcription activation domain (N-TA, by homology) [6]. FT 111 175 PF00170; bZIP transcription factor. FT 111 175 SM00338; brlzneu. FT 113 176 PS50217; BZIP. XX SF expressed as a gag-fos fusion protein of 75 kDa [3]; XX FF activator [7]; FF nuclear translocation appears not to be controlled by external signals (in contrast to c-Fos) [5]; FF trans-activation by and DNA-binding of the gag-fos fusion protein is decreased compared with c-Fos due to N-terminal myristylation [1]; FF transformation by FBR, however, depends on the gag-fos myristylation [7]; FF activation of the alpha(III) collagen promoter operates through interaction of a negative regulatory region with C/EBPalpha [7]; XX IN T00131 c-Jun; mouse, Mus musculus. IN T00132 c-Jun; rat, Rattus norvegicus. IN T00133 c-Jun; human, Homo sapiens. IN T00134 c-Jun; chick, Gallus gallus. IN T00135 c-Jun; hamster, Cricetulus sp. IN T01436 MafF; chick, Gallus gallus. IN T01437 MafG; chick, Gallus gallus. IN T01434 MafK; chick, Gallus gallus. IN T01435 MafK; mouse, Mus musculus. IN T01430 v-Maf; AS42, avian musculoaponeurotic fibrosarcoma virus. XX BS R02963. BS R04116. XX DR TRANSPATH: MO000025247. DR EMBL: K02712; DR UniProtKB: P29176; XX RN [1]; RE0001581. RX PUBMED: 1846672. RA Kamata N., Jotte R. M., Holt J. T. RT Myristylation alters DNA-binding activity and transactivation of FBR (gag-fos) protein RL Mol. Cell. Biol. 11:765-772 (1991). RN [2]; RE0002917. RX PUBMED: 8264639. RA Kataoka K., Noda M., Nishizawa M. RT Maf nuclear oncoprotein recognizes sequences related to an AP-1 site and forms heterodimers with both Fos and Jun RL Mol. Cell. Biol. 14:700-712 (1994). RN [3]; RE0004800. RX PUBMED: 6203214. RA Curran T., Verma I. M. RT FBR murine osteosarcoma virus RL Virology 135:218-228 (1984). RN [4]; RE0004801. RX PUBMED: 6383726. RA Mueller R., Verma I. M. RT Expression of cellular oncogenes RL Curr. Top. Microbiol. Immunol. 112:73-115 (1984). RN [5]; RE0004830. RX PUBMED: 2119889. RA Roux P., Blanchard J.-M., Fernandez A., Lamb N., Jeanteur P., Piechaczyk M. RT Nuclear localization of c-Fos, but not v-Fos proteins, is controlled by extracellular signals RL Cell 63:341-351 (1990). RN [6]; RE0004887. RX PUBMED: 8137828. RA Jooss K. U., Funk M., Mueller R. RT An autonomous N-terminal transactivation domain in Fos protein plays a crucial role in transformation RL EMBO J. 13:1467-1475 (1994). RN [7]; RE0007060. RX PUBMED: 8206947. RA Jotte R. M., Kamata N., Holt J. T. RT Myristylation-dependent transactivation by FBR v-fos is regulated by C/EBP RL J. Biol. Chem. 269:16383-16396 (1994). XX //