
AC T06004
XX
ID T06004
XX
DT 07.06.2004 (created); cch.
DT 23.02.2016 (updated); jmh.
CO Copyright (C), QIAGEN.
XX
FA p63-isoform2
XX
SY delN p63alpha; DeltaN p63alpha; DeltaN-alpha; DeltaNp63alpha; DN p63alpha; N-terminally truncated p63alpha; new_synonym; P51delNalpha.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G009616 TP63; HGNC: TP63.
XX
CL C0057; P53; 6.3.1.0.2.2.
XX
SZ 586 AA; 65.8 kDa (calc.).
XX
SQ MLYLENNAQTQFSEPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSS
SQ TFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIK
SQ VMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQ
SQ YVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQV
SQ LGRRCFEARICACPGRDRKADEDSIRKQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRR
SQ SPDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQ
SQ SPSSYGNSSPPLNKMNSMNKLPSVSQLINPQQRNALTPTTIPDGMGANIPMMGTHMPMAG
SQ DMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIY
SQ QIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETR
SQ GERVIDAVRFTLRQTISFPPRDEWNDFNFDMDARRNKQQRIKEEGE
XX
SC translated from EMBL #AF075431
XX
FT 58 351
PF00478; IMP dehydrogenase / GMP reductase domain.
FT 69 265
PF00870; P53 DNA-binding domain.
FT 297 338
PF07710; P53 tetramerisation motif.
FT 447 513
PF07647; SAM domain (Sterile alpha motif).
FT 447 513
SM00454; SAM.
XX
SF several alternative products are known, p63alpha T06132, p63beta T06133, p63gamma T06135, p63delta T06005, DeltaN p63alpha T06004, DeltaN p63beta T06134, DeltaNp63gamma T06136 [1] [2];
SF lack N-terminal transactivation domain in comparison with p63alpha [1];
SF SAM domain is important for transcriptional repression function [3];
XX
CP basal epithelial cells of different organs, where it is a predominant isoform of p63; predominant isoform of p63 in HEK (human epidermal keratinocytes) and is downregulated during differentiation [3].
XX
FF repressor [3] [4];
FF acts as a dominant-negative suppressor of p63gamma and of p53 [1] [3];
FF can function as a moderate activator [5];
FF binds p53 consensus elements [3] [4];
FF overexpressed (by gene amplification) in lung cancers [7];
FF blocks keratinocyte differentiation and promotes cell survival [8];
FF has oncogenic properties [7] [8];
FF phosphoprotein [3];
FF negative autoregulatory loop: deltaNp63alpha negatively regulates its own promoter in response to DNA damage [4];
FF transcription is regulated by EGF via PI3K pathway [6];
XX
IN T02853 hnRNPK; human, Homo sapiens.
IN T13796 TLS; human, Homo sapiens.
IN T22876 YAP; human, Homo sapiens.
XX
MX M00761 V$P53DECAMER_Q2.
XX
BS R61348.
BS R61347.
BS R15746.
BS R15747.
BS R72121.
BS R72123.
BS R61360.
BS R61361.
BS R61339.
BS R61326.
BS R63382.
BS R63492.
BS R56560.
BS R63453.
BS R56574.
BS R56578.
BS R61343.
BS R61345.
BS R61340.
BS R61331.
BS R61332.
BS R15748.
BS R15749.
BS R61337.
BS R15768.
BS R61350.
BS R68687.
BS R61334.
XX
DR TRANSPATH: MO000043793.
DR EMBL: AF075431;
DR EMBL: AF124539;
DR UniProtKB: Q9H3D4-2;
XX
RN [1]; RE0024711.
RX PUBMED: 9774969.
RA Yang A., Kaghad M., Wang Y., Gillett E., Fleming M. D., Dotsch V., Andrews N. C., Caput D., McKeon F.
RT p63, a p53 homolog at 3q27-29, encodes multiple products with transactivating, death-inducing, and dominant-negative activities.
RL Mol. Cell 2:305-316 (1998).
RN [2]; RE0024715.
RX PUBMED: 11477076.
RA Klein C., Georges G., Kunkele K. P., Huber R., Engh R. A., Hansen S.
RT High thermostability and lack of cooperative DNA binding distinguish the p63 core domain from the homologous tumor suppressor p53.
RL J. Biol. Chem. 276:37390-37401 (2001).
RN [3]; RE0024939.
RX PUBMED: 12640112.
RA Westfall M. D., Mays D. J., Sniezek J. C., Pietenpol J. A.
RT The Delta Np63 alpha phosphoprotein binds the p21 and 14-3-3 sigma promoters in vivo and has transcriptional repressor activity that is reduced by Hay-Wells syndrome-derived mutations.
RL Mol. Cell. Biol. 23:2264-2276 (2003).
RN [4]; RE0024955.
RX PUBMED: 14576823.
RA Harmes D. C., Bresnick E., Lubin E. A., Watson J. K., Heim K. E., Curtin J. C., Suskind A. M., Lamb J., DiRenzo J.
RT Positive and negative regulation of deltaN-p63 promoter activity by p53 and deltaN-p63-alpha contributes to differential regulation of p53 target genes.
RL Oncogene 22:7607-7616 (2003).
RN [5]; RE0024970.
RX PUBMED: 12453409.
RA Ellisen L. W., Ramsayer K. D., Johannessen C. M., Yang A., Beppu H., Minda K., Oliner J. D., McKeon F., Haber D. A.
RT REDD1, a developmentally regulated transcriptional target of p63 and p53, links p63 to regulation of reactive oxygen species.
RL Mol. Cell 10:995-1005 (2002).
RN [6]; RE0024973.
RX PUBMED: 14555649.
RA Barbieri C. E., Barton C. E., Pietenpol J. A.
RT Delta Np63 alpha expression is regulated by the phosphoinositide 3-kinase pathway.
RL J. Biol. Chem. 278:51408-51414 (2003).
RN [7]; RE0024975.
RX PUBMED: 14612504.
RA Massion P. P., Taflan P. M., Jamshedur Rahman S. M., Yildiz P., Shyr Y., Edgerton M. E., Westfall M. D., Roberts J. R., Pietenpol J. A., Carbone D. P., Gonzalez A. L.
RT Significance of p63 amplification and overexpression in lung cancer development and prognosis.
RL Cancer Res. 63:7113-7121 (2003).
RN [8]; RE0024976.
RX PUBMED: 12789272.
RA King K. E., Ponnamperuma R. M., Yamashita T., Tokino T., Lee L. A., Young M. F., Weinberg W. C.
RT deltaNp63alpha functions as both a positive and a negative transcriptional regulator and blocks in vitro differentiation of murine keratinocytes.
RL Oncogene 22:3635-3644 (2003).
RN [9]; RE0049696.
RX PUBMED: 15539951.
RA Huang Y. P., Wu G., Guo Z., Osada M., Fomenkov T., Park H. L., Trink B., Sidransky D., Fomenkov A., Ratovitski E. A.
RT Altered sumoylation of p63alpha contributes to the split-hand/foot malformation phenotype.
RL Cell Cycle 3:1587-1596 (2004).
RN [10]; RE0050255.
RX PUBMED: 16861923.
RA Rossi M., De Simone M., Pollice A., Santoro R., La Mantia G., Guerrini L., Calabro V.
RT Itch/AIP4 associates with and promotes p63 protein degradation.
RL Cell Cycle 5:1816-1822 (2006).
RN [11]; RE0050461.
RX PUBMED: 16908849.
RA Rossi M., Aqeilan R. I., Neale M., Candi E., Salomoni P., Knight R. A., Croce C. M., Melino G.
RT The E3 ubiquitin ligase Itch controls the protein stability of p63.
RL Proc. Natl. Acad. Sci. USA 103:12753-12758 (2006).
XX
//