TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T06135 XX ID T06135 XX DT 09.09.2004 (created); oke. DT 01.08.2014 (updated); sla. CO Copyright (C), QIAGEN. XX FA p63-isoform5 XX SY P51A; TA p63 gamma. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G009616 TP63; HGNC: TP63. XX CL C0057; P53; 6.3.1.0.2.5. XX SZ 487 AA; 55.7 kDa (calc.). XX SQ MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWD SQ FLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSM SQ DQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVS SQ FQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEV SQ VKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFT SQ TVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIR SQ KQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKES SQ LELMQYLPQHTIETYRQQQQQQHQHLLQKHLLSACFRNELVEPRRETPKQSDVFFRHSKP SQ PNRSVYP XX SC Swiss-Prot#Q9H3D4-5 XX FT 152 445 PF00478; IMP dehydrogenase / GMP reductase domain. FT 153 388 DNA binding domain, DBD [3]. FT 163 359 PF00870; P53 DNA-binding domain. FT 391 432 PF07710; P53 tetramerisation motif. XX SF several alternative products are known, p63alpha T06132, p63beta T06133, p63-isoform5 T06135, p63delta T06005, DeltaN p63alpha T06004, DeltaN p63beta T06134, DeltaNp63-isoform5 T06136 [2] [3]; SF has transactivation, DNA binding and oligomerization domains [2]; SF in this splice variant exons 11, 12, 13, 14 are absent in comparison with p63alpha T06132 [2]; SF N-terminal domain is required for direct interaction with SSRP1 T01003 [1]; XX FF strong transcriptional activator, can activate gene transcription through a p53 binding site [1] [2] [4] [5] [6]; FF similar to p53, is able to induce apoptosis [2]; FF recruits co-activator SSRP1 T01003 [1]; FF is implicated in the activation of Notch signaling pathway [6]; FF ASPP1 and ASPP2 stimulate transcriptional activity of p63-isoform5 on promoters of Bax, PIG3, and PUMA but not of mdm2 and p21 [7]; XX IN T06367 ASPP1; human, Homo sapiens. IN T06368 ASPP2; human, Homo sapiens. IN T02944 Daxx; human, Homo sapiens. IN T01003 SSRP1; human, Homo sapiens. XX MX M00761 V$P53DECAMER_Q2. XX BS R04373. BS R15772. BS R11385. BS R11386. XX DR TRANSPATH: MO000042288. DR EMBL: AF124540; AF124540. DR UniProtKB: Q9H3D4-5; XX RN [1]; RE0024348. RX PUBMED: 12374749. RA Zeng S. X., Dai M. S., Keller D. M., Lu H. RT SSRP1 functions as a co-activator of the transcriptional activator p63. RL EMBO J. 21:5487-5497 (2002). RN [2]; RE0024711. RX PUBMED: 9774969. RA Yang A., Kaghad M., Wang Y., Gillett E., Fleming M. D., Dotsch V., Andrews N. C., Caput D., McKeon F. RT p63, a p53 homolog at 3q27-29, encodes multiple products with transactivating, death-inducing, and dominant-negative activities. RL Mol. Cell 2:305-316 (1998). RN [3]; RE0024715. RX PUBMED: 11477076. RA Klein C., Georges G., Kunkele K. P., Huber R., Engh R. A., Hansen S. RT High thermostability and lack of cooperative DNA binding distinguish the p63 core domain from the homologous tumor suppressor p53. RL J. Biol. Chem. 276:37390-37401 (2001). RN [4]; RE0024964. RX PUBMED: 10383130. RA Shimada A., Kato S., Enjo K., Osada M., Ikawa Y., Kohno K., Obinata M., Kanamaru R., Ikawa S., Ishioka C. RT The transcriptional activities of p53 and its homologue p51/p63: similarities and differences. RL Cancer Res. 59:2781-2786 (1999). RN [5]; RE0024970. RX PUBMED: 12453409. RA Ellisen L. W., Ramsayer K. D., Johannessen C. M., Yang A., Beppu H., Minda K., Oliner J. D., McKeon F., Haber D. A. RT REDD1, a developmentally regulated transcriptional target of p63 and p53, links p63 to regulation of reactive oxygen species. RL Mol. Cell 10:995-1005 (2002). RN [6]; RE0024972. RX PUBMED: 11641404. RA Sasaki Y., Ishida S., Morimoto I., Yamashita T., Kojima T., Kihara C., Tanaka T., Imai K., Nakamura Y., Tokino T. RT The p53 family member genes are involved in the Notch signal pathway. RL J. Biol. Chem. 277:719-724 (2002). RN [7]; RE0025178. RX PUBMED: 14729977. RA Bergamaschi D., Samuels Y., Jin B., Duraisingham S., Crook T., Lu X. RT ASPP1 and ASPP2: common activators of p53 family members. RL Mol. Cell. Biol. 24:1341-1350 (2004). XX //