TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00432 XX ID T00432 XX DT 20.10.1992 (created); ewi. DT 08.03.2012 (updated); mkl. CO Copyright (C), QIAGEN. XX FA ITF-1 XX SY E2-5; ITF-1. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G003922 TCF3; HGNC: TCF3. XX CL C0010; bHLH. XX SZ 582 AA; 59.9 kDa (cDNA) (calc.). XX SQ GGGECLAWCGPSAVHRCADVGLGMVSARTAPGKSGERGAYASFGRDAGVGGLTQAGFLSG SQ ELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGLPSSVYPPS SQ SGEDYGRDATAYPSAKTPSSTYPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLP SQ LPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHT SQ PPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQ SQ WPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLPGHGALASG SQ FTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRA SQ GATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSTDEVLSLEEKDLRDRERRM SQ ANNARERVRVRDINEAFRELGRMCQMHLKSDKAQTKLLILQQAVQVILGLEQQVRERNLN SQ PKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM XX SC Swiss-Prot#P15883 (partial sequence) XX FT 36 514 PF00478; IMP dehydrogenase / GMP reductase domain. FT 475 531 PS50888; HLH. FT 478 531 PF00010; Helix-loop-helix DNA-binding domain. FT 483 536 SM00353; finulus. XX SF splice variant of E12, identical to E47 except its first exon [2]; XX FF activator; FF cooperating with TFE3, it can mediate lymphoid-specific activation through IgH enhancer elements muE5 and muE3; FF in this context, ITF-1 displaces a repressor (ZEB) thus giving way for activation by TFE3 [1]; XX IN T00403 Id1; mouse, Mus musculus. IN T00433 ITF-2; human, Homo sapiens. IN T10018 Lyl-1; human, Homo sapiens. IN T00521 Myf-5; human, Homo sapiens. IN T00949 Myf-5; clawed frog, Xenopus laevis. IN T00522 Myf-6; human, Homo sapiens. IN T00524 MyoD; clawed frog, Xenopus laevis. IN T00525 MyoD; human, Homo sapiens. IN T00526 MyoD; mouse, Mus musculus. IN T00527 MyoD; monkey, Cercopithecus aethiops. IN T01128 MyoD; chick, Gallus gallus. IN T00520 Myogenin; human, Homo sapiens. XX MX M00693 V$E12_Q6. MX M00804 V$E2A_Q2. MX M00973 V$E2A_Q6. MX M07353 V$E2A_Q6_02. MX M00002 V$E47_01. MX M00071 V$E47_02. MX M01034 V$EBOX_Q6_01. MX M00222 V$HAND1E47_01. MX M00929 V$MYOD_Q6_01. MX M00066 V$TAL1ALPHAE47_01. MX M00065 V$TAL1BETAE47_01. XX BS R04158. BS R00913. XX DR TRANSPATH: MO000024920. DR TRANSCOMPEL: C00031. DR TRANSCOMPEL: C00035. DR EMBL: X52078; DR UniProtKB: P15923; XX RN [1]; RE0000670. RX PUBMED: 1899229. RA Ruezinsky D., Beckmann H., Kadesh T. RT Modulation of the Igh enhancer's cell type through a genetic switch RL Genes Dev. 5:29-37 (1991). RN [2]; RE0002107. RX PUBMED: 2308859. RA Henthorn P., McCarrick-Walmsley R., Kadesch T. RT Sequence of the cDNA encoding ITF-1, a positive-acting transcription factor RL Nucleic Acids Res. 18:677-677 (1990). RN [3]; RE0002660. RX PUBMED: 2105528. RA Henthorn P., Kiledjian M., Kadesch T. RT Two distinct transcription factors that bind the immunoglobulin enhancer muE5/kappaE2 motif RL Science 247:467-470 (1990). RN [4]; RE0002863. RX PUBMED: 1944284. RA Wilson R. B., Kiledjian M., Shen C.-P., Benezra R., Zwollo P., Dymecki S. M., Desiderio S. V., Kadesch T. RT Repression of immunoglobulin enhancers by the helix-loop-helix protein Id: implications for B-lymphoid-cell development RL Mol. Cell. Biol. 11:6185-6191 (1991). RN [5]; RE0003743. RX PUBMED: 8065348. RA Genetta T., Ruezinsky D., Kadesch T. RT Displacement of an E-box-binding repressor by basic helix-loop-helix proteins: implications for B-cell specificity of the immunoglobulin heavy-chain enhancer RL Mol. Cell. Biol. 14:6153-6163 (1994). RN [6]; RE0012731. RX PUBMED: 8628307. RA Miyamoto A., Cui X., Naumovski L., Cleary M. L. RT Helix-loop-helix proteins LYL1 and E2a form heterodimeric complexes with distinctive DNA-binding properties in hematolymphoid cells RL Mol. Cell. Biol. 16:2394-2401 (1996). XX //